KEGG   Mus musculus (mouse): 11769Help
Entry
11769             CDS       T01002                                 

Gene name
Ap1s1, AP19
Definition
(RefSeq) adaptor protein complex AP-1, sigma 1
  KO
K12394  AP-1 complex subunit sigma 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11769 (Ap1s1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    11769 (Ap1s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11769 (Ap1s1)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    11769 (Ap1s1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s DEK_C CNOT1_HEAT
Motif
Other DBs
NCBI-GeneID: 11769
NCBI-ProteinID: NP_031483
MGI: 1098244
Ensembl: ENSMUSG00000004849
Vega: OTTMUSG00000023414
UniProt: P61967
Structure
PDB: 

Position
5; 5 G2
AA seq 158 aa AA seqDB search
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYK
RYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMG
GDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgattcatgctactgttcagccggcagggaaaacttcggctacaaaaatggtac
ctggccacctcagacaaggagaggaagaagatggtccgagagctcatgcaagtcgtcctg
gctagaaagcccaaaatgtgcagcttcctggagtggagggacctcaaagttgtctataag
agatacgccagtctctatttctgctgcgccatcgaaggccaagacaacgagctgatcaca
ctggagctgatccaccgatacgtagagctcttggacaagtacttcggcagcgtatgtgag
ttggacatcatcttcaactttgagaaagcctactttatcctggacgagtttctgatgggt
ggggatgtccaggacacctccaagaagagtgtgctcaaggccattgagcaggctgacctg
ctgcaggaggaggatgagtcgccgcgcagtgtcctggaggagatgggcctggcatag

DBGET integrated database retrieval system