KEGG   Mus musculus (mouse): 11770Help
Entry
11770             CDS       T01002                                 

Gene name
Fabp4, 422/aP2, AFABP, ALBP, ALBP/Ap2, Ap2, Lbpl, P15
Definition
(RefSeq) fatty acid binding protein 4, adipocyte
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    11770 (Fabp4)
   03320 PPAR signaling pathway
    11770 (Fabp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7
Motif
Other DBs
NCBI-GeneID: 11770
NCBI-ProteinID: NP_077717
MGI: 88038
Ensembl: ENSMUSG00000062515
Vega: OTTMUSG00000051458
UniProt: P04117 Q542H7
Structure
PDB: 

Position
3 A1; 3 2.56 cM
AA seq 132 aa AA seqDB search
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDLVTIRSESTFKN
TEISFKLGVEFDEITADDRKVKSIITLDGGALVQVQKWDGKSTTIKRKRDGDKLVVECVM
KGVTSTRVYERA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgcctttgtgggaacctggaagcttgtctccagtgaaaacttcgatgattac
atgaaagaagtgggagtgggctttgccacaaggaaagtggcaggcatggccaagcccaac
atgatcatcagcgtaaatggggatttggtcaccatccggtcagagagtacttttaaaaac
accgagatttccttcaaactgggcgtggaattcgatgaaatcaccgcagacgacaggaag
gtgaagagcatcataaccctagatggcggggccctggtgcaggtgcagaagtgggatgga
aagtcgaccacaataaagagaaaacgagatggtgacaagctggtggtggaatgtgttatg
aaaggcgtgacttccacaagagtttatgaaagggcatga

DBGET integrated database retrieval system