KEGG   Mus musculus (mouse): 11771Help
Entry
11771             CDS       T01002                                 

Gene name
Ap2a1, Adtaa
Definition
(RefSeq) adaptor-related protein complex 2, alpha 1 subunit
  KO
K11824  AP-2 complex subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04721  Synaptic vesicle cycle
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11771 (Ap2a1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    11771 (Ap2a1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11771 (Ap2a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    11771 (Ap2a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11771 (Ap2a1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11771 (Ap2a1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    11771 (Ap2a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   11771 (Ap2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1 Dymeclin
Motif
Other DBs
NCBI-GeneID: 11771
NCBI-ProteinID: NP_031484
MGI: 101921
Ensembl: ENSMUSG00000060279
Vega: OTTMUSG00000035384
UniProt: P17426
Position
7; 7 B3
AA seq 977 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCISLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAASALDDSRRDTSSNDINGGVEPTPSTVSTPSPSADL
LGLRAAPPPAAPPAPVGGNLLVDVFSDGPTAQPSLGPTPEEAFLSELEPPAPESPMALLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNSGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQNFLPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGTAQSLTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPLQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggctgtatccaaaggcgatggcatgcgtgggctcgccgtgttcatctccgacatc
cggaactgcaagagcaaagaggctgagatcaagaggatcaacaaggaactggccaacatc
cgttccaagttcaaaggggacaaggccttggatggctacagtaaaaagaagtatgtgtgt
aagctgctcttcatattcctgcttggccatgacattgactttggacatatggaggccgtg
aacctgctaagctctaacaagtacacggagaagcagatagggtacctgttcatctcagtc
ctggtgaactcgaactcagaactgatccggctcatcaacaacgctatcaagaatgacctg
gccagtcgcaaccccaccttcatgtgcctggccttgcactgtatcgctaacgtgggcagc
cgtgagatgggcgaggcttttgctgcagacattccccgaatcctggtggctggggacagc
atggacagtgtgaagcagagtgccgccctatgcctactgcgactctacaaggcctcgccc
gacttggtgcccatgggcgagtggacggcacgtgtagtgcacttgctcaatgatcagcac
atgggagtggtcacagctgctgtcagcctcatcacctgtctctgcaagaagaatccggat
gacttcaagacctgtatctccctggctgtgtctcgcttaagccggatcgtctcctcagcc
tccactgacctccaggactacacttactacttcgttcctgcaccctggctctctgtgaag
ctactgcggctgctccagtgttacccaccaccagaggatgcagccgtgaaagggcggtta
gtggagtgtctggagactgtgctcaacaaggcccaggagcctcccaagtccaagaaggtg
cagcactccaacgccaagaacgctatcctctttgagaccattagcctcatcatccactat
gacagtgagcccaacctcctggtccgcgcctgcaaccagctgggccagttcctgcagcac
cgggagactaacctgcgctacctggccctggagagcatgtgcacgctggccagctccgag
ttctcccacgaggccgtcaagacccacattgatacagttattaatgccctcaagacggag
cgggacgtcagtgtgaggcagcgggcggctgatctcctgtatgccatgtgtgaccggagc
aatgccaagcagattgtgtcagagatgctgcggtacctggagactgctgactatgccatc
cgagaggagatcgtgctgaaggtggccatcctggctgagaagtatgcagtggactacagc
tggtacgtggacaccatcctcaacctcatccgcatcgcgggcgactatgtgagcgaggag
gtgtggtaccgcgtgctgcagatcgtcaccaaccgtgatgacgtccagggttatgctgcc
aagacagtgtttgaggccctccaggccccagcctgtcatgagaacatggtgaaggtcggt
ggctacatccttggggagtttgggaacttgattgctggggacccacgctccagcccacca
gtgcagttctcgctgctgcactccaagttccacctgtgcagcgtggccacccgcgctctg
ttgctgtccacctacatcaagttcatcaacctcttccctgagaccaaggccaccatccaa
ggggttctgcgtgccggctcccagctgcgaaatgccgacgtggagctacagcagcgggcc
gtggagtacctcaccctcagctccgtagccagcaccgatgttctggctacggtgctagaa
gaaatgcccccatttcccgagcgggagtcgtccatcttggccaagctgaagcgcaagaag
ggccctggggcagccagtgccctagatgacagccgcagggacaccagcagcaatgacatc
aatgggggtgtggagcccacccccagcactgtgtcgaccccctcaccctccgcggacctc
ttagggctgcgggcagcccctccccctgctgcacccccggctcccgtaggcgggaacctc
ctggtggatgtcttctctgacggccccactgcacagcccagcctggggcccactcctgag
gaggccttcctcagcgagctggagccccctgcccctgagagccccatggctttgttggct
gacccagctccagctgctgacccaggtcctgaggacataggccctcccattccagaagca
gatgaactgttgaataagttcgtgtgtaagaatagtggggtcttgtttgagaaccagctg
ctgcagattggagtcaagtctgagttccggcagaacctgggccgcatgtatctcttctat
ggcaacaagacttctgtgcagttccagaacttcttgcccaccgtggtccatcctggggac
ctccagactcagctggcggtgcagaccaagcgtgtggcggcacaagtggacggtggcgca
caggtgcagcaagtactcaacattgagtgtctgcgagacttcctgacgccgccactgttg
tcggtgcgcttccggtacggtggcaccgcccagtccctcactctgaagctcccagtgacc
atcaacaaattcttccagcccacagagatggcggcccaagactttttccagcgctggaag
cagctgagcctccccctgcaggaggcacagaaaatcttcaaagccaaccacccgatggat
gctgaagttactaaggccaagcttctggggtttggctctgctcttctggacaatgtggat
cccaaccctgagaactttgtgggtgctggaatcatccagacgaaggccctgcaggtgggg
tgtctgcttcggctggagcccaatgcccaggcccaaatgtaccgtctaaccctgcgcacc
agcaaagagcctgtctcccgtcacttgtgtgagctgctggcccagcagttctga

DBGET integrated database retrieval system