KEGG   Mus musculus (house mouse): 11773
Entry
11773             CDS       T01002                                 
Symbol
Ap2m1
Name
(RefSeq) adaptor-related protein complex 2, mu 1 subunit
  KO
K11826  AP-2 complex subunit mu-1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
mmu04721  Synaptic vesicle cycle
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11773 (Ap2m1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    11773 (Ap2m1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    11773 (Ap2m1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    11773 (Ap2m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11773 (Ap2m1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    11773 (Ap2m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s muHD
Other DBs
NCBI-GeneID: 11773
NCBI-ProteinID: NP_033809
MGI: 1298405
Ensembl: ENSMUSG00000022841
UniProt: P84091 Q5FWI9
Structure
Position
16:20354230..20363659
AA seq 435 aa
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS
IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG
MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgatcggaggcttattcatctataatcacaagggggaggtgcttatctcccgggtctac
agagatgacatcgggaggaatgctgtggatgcctttcgggtcaatgtcattcatgcacgg
cagcaggtgcgcagccctgtcacaaacatcgctcgcaccagcttcttccatgttaagcgg
tccaacatctggctggccgcagtcaccaagcagaatgtcaatgctgccatggtcttcgaa
ttcctctacaagatgtgtgatgtaatggctgcttactttggcaaaatcagcgaggagaac
atcaagaacaattttgtgctcatatacgagctgctggatgagattctggactttggctac
ccacagaactcagagacaggtgcactgaaaaccttcatcacccagcagggtatcaagagt
cagcatcagacgaaggaagaacagtcccagatcaccagccaggtgaccgggcagattggc
tggcggcgagaaggcatcaagtatcgccggaatgaactcttcctagatgttctggagagt
gtgaacctgcttatgtccccacaggggcaggtgctgagtgcccatgtgtcaggccgggtg
gtgatgaagagttacctgagtggcatgcctgagtgcaagtttggaatgaatgacaagatt
gtcatagaaaagcagggcaaaggcacagctgatgaaacaagcaagagtggtaagcagtcg
atcgccattgatgactgcaccttccaccagtgtgtgcgactcagcaagtttgactctgag
cggagcatcagcttcatccctcccgacggagagtttgaactcatgagataccgtactacc
aaggacatcatccttcctttccgggtgatcccattggtgcgggaggtggggcgcaccaaa
ctggaggtcaaggtggtcatcaagtccaacttcaagccctcacttctggcccagaagatt
gaggtgaggatcccgactccattgaacacaagcggggtacaggtgatctgcatgaagggg
aaggccaagtacaaggccagcgagaacgccattgtatggaagatcaagcgcatggcaggc
atgaaggaatcccagatcagcgcagagattgagctcctgcccaccaacgataagaagaaa
tgggctcggccccccatttccatgaactttgaggtgccattcgcgccttctggcctcaag
gtgcgctacttgaaggtattcgaaccgaagctgaactacagcgaccatgatgtcatcaaa
tgggtgcgatacattggccgcagtggcatttatgaaacccgctgctag

DBGET integrated database retrieval system