KEGG   Mus musculus (house mouse): 11774
Entry
11774             CDS       T01002                                 
Symbol
Ap3b1, AP-3, AU015684, C78395, Hps2, beta3A, pe, pearl, rim2
Name
(RefSeq) adaptor-related protein complex 3, beta 1 subunit
  KO
K12397  AP-3 complex subunit beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11774 (Ap3b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11774 (Ap3b1)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    11774 (Ap3b1)
 Endosome - Golgi transport
    11774 (Ap3b1)
SSDB
Motif
Pfam: Adaptin_N AP3B1_C Cnd1 SEEEED HEAT_2
Other DBs
NCBI-GeneID: 11774
NCBI-ProteinID: NP_033810
MGI: 1333879
Ensembl: ENSMUSG00000021686
UniProt: Q9Z1T1 Q3UPG0 Q3TQ07
Position
13:94492332..94702838
AA seq 1105 aa
MSSNSFAYNEQSGGGEAAELGQEATSTISPSGAFGLFSSDWKKNEDLKQMLESNKDSAKL
DAMKRIVGMIAKGKNASELFPAVVKNVASKNIEIKKLVYVYLVRYAEEQQDLALLSISTF
QRALKDPNQLIRASALRVLSSIRVPIIVPVMMLAIKEASADLSPYVRKNAAHAIQKLYSL
DPEQKEMLIEVIEKLLKDKSTLVAGSVVMAFEEVCPDRIDLIHRNYRKLCNLLVDVEEWG
QVVIIHMLTRYARTQFVSPWREDGGLEDNEKNFYESEEEEEEKEKSSRKKSYAMDPDHRL
LIRNTKPLLQSRNAAVVMAVAQLYWHISPKSEAGVISKSLVRLLRSNREVQYIVLQNIAT
MSIERKGMFEPYLKSFYVRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVRSQDKQ
FAAATIQTIGRCATSISEVTDTCLNGLVCLLSNRDEIVVAESVVVIKKLLQMQPAQHGEI
IRHMAKLLDSITVPVARASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNL
AAKLYLTNSKQTKLLTQYILNLGKYDQNYDIRDRTRFIRQLIVPNEKSGALSKYAKKIFL
APKPAPLLESPFKDRDRFQLGTLSHTLNIKASGYLELSNWPEVAPDPSVRNVEVIESAKE
WTPLGKTKKEKPMKKFYSESEEEEDEDEDEDEEEEEKEDEDENPSDSSSDSESGSGSESG
DTGTEDSSEDSSSGQDSETGSQAEAERQKVAKRNSKTKRKSDSENREKKNENSKASESSS
EESSSMEDSSSESESESGSDSEPAPRNVAPAKERKPQQERHPPSKDVFLLDLDDFNPVST
PVALPTPALSPSLIADLEGLNLSTSSSVINVSTPVFVPTKTHELLHRMHGKGLAAHYCFP
RQPCIFSDKMVSVQITLTNTSDRKIENIHIGGKGLPVGMQMHAFHPIDSLEPKGSVTVSV
GIDFCDSTQTASFQLCTKDDCFNVTLQPPVGELLSPVAMSEKDFKKEQGTLTGMNETSAT
LIAAPQNFTPSMILQKVVNVANLGAVPSSQDNVHRFAARTVHSGSLMLVTVELKEGSTAQ
LIINTEKTVIGSVLLRELKPVLSQG
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgtctagcaacagtttcgcctacaacgagcagtcgggaggaggggaggcggcggagctc
gggcaggaggccacctcgaccatctctccctcgggcgccttcggcctcttcagcagcgat
tggaagaagaatgaagacctgaagcagatgctggagagcaacaaagattctgccaagcta
gatgctatgaagcgaattgttgggatgattgcgaaggggaaaaatgcctcggaactcttc
cctgctgttgtgaagaatgtggccagtaaaaacatcgagatcaagaagttggtgtacgtt
taccttgtccgatatgctgaagaacagcaggacctggctcttctgtccataagcactttc
cagcgagctttgaaggacccgaatcaactaatccgtgcaagtgccttgagagttttgtca
agtattagagtgccaattatcgtgcctgtcatgatgctggctattaaggaggcttcagct
gacctgtcgccatatgttaggaagaatgcagcccatgctattcagaagctgtacagtctt
gaccccgagcagaaggagatgttaattgaagtcattgagaagcttctgaaagacaagagc
acgctggtggctggcagtgtggtgatggcctttgaagaagtgtgcccggatagaatcgat
ctgattcacaggaattaccgaaagctttgtaacctgctggttgatgttgaagagtggggg
caggtggtcataatccatatgctaacaagatacgctcggacccagtttgtcagtccttgg
agagaggatggtggtctggaagacaatgagaagaacttctatgaatctgaggaggaggag
gaggagaaggagaagagcagcaggaagaagtcgtatgccatggacccagaccacagactc
ttaattagaaacaccaagccgttgcttcagagcaggaatgcagcggtggttatggctgtc
gctcagctatattggcacatctcacccaagtcggaggctggtgtcatttctaaatcactg
gtgcgcttattgcgcagcaatagggaggtgcagtatattgtattgcaaaatattgcaact
atgtcaattgagagaaagggtatgtttgaaccttacctgaagagtttctatgtcagatcc
actgatccaactatgatcaaaacactgaagcttgaaattttgacaaacttggcaaatgaa
gccaacatatcaactcttcttcgagaatttcagacctacgtgagaagccaggacaaacag
tttgcagcagccactattcagaccataggcagatgtgcaaccagcattagcgaggtcacc
gacacatgcctcaacggcctggtctgcctgctgtccaacagggatgaaatagttgttgct
gagagtgtggttgttataaagaaattgttgcaaatgcagcctgcacagcatggtgaaatt
atcagacatatggccaagctcttggacagtatcactgttcctgtggctagagcaagcatc
ctttggctaattggagaaaactgtgaacgagttcctaaaattgctcctgatgttttgagg
aaaatggctaaaagtttcactagtgaagatgatctcgtgaaactgcagattttaaatctt
gcagcaaaattgtatttaactaattccaaacagacaaaattgcttacccagtacatatta
aatctcggcaagtatgatcaaaactacgacatcagagaccgcacacgatttattaggcag
cttattgttccgaacgagaagagtggagccttaagtaaatatgccaaaaaaatcttccta
gcaccgaagcctgcgccactgctcgagtctccctttaaagatagggatcgcttccagctt
ggcaccttatctcatactctcaacattaaagcgtccgggtacctggaattatctaattgg
ccagaggtggcgcctgacccatcggttcgcaatgtagaagtaatagagtcagcaaaagaa
tggaccccacttgggaaaacaaagaaagaaaaacccatgaagaaattttactctgaatct
gaggaggaggaggacgaggacgaggatgaggacgaggaggaggaagaaaaggaagatgag
gatgagaacccctctgatagcagcagtgacagtgagagcgggtccggaagtgagagtgga
gacacaggcaccgaggacagcagtgaggactcgtccagtggacaagacagcgagaccgga
agccaggcagaagcggaacgccagaaggtggccaagaggaactccaaaaccaagaggaaa
agtgattcagaaaatagggagaagaaaaatgaaaactcaaaagcttctgaatcgtccagt
gaggagtccagttccatggaagacagttcttccgagtcagagtcagagtcaggctctgac
agtgagcctgcgcccagaaacgtggctccggcaaaagaaagaaaaccccagcaagaaaga
catcctccctccaaagatgttttccttctagatctggacgactttaacccagtatccacc
ccagttgcccttcctacaccagccctttctccaagcttgatagctgatcttgaaggtcta
aacttgtcaacttcttcatcagtcatcaacgtcagtacgcctgtcttcgtgccaacaaaa
acacatgagctgcttcaccgaatgcatgggaaaggactggccgcccactactgcttccca
agacagccctgcatcttcagtgacaagatggtctctgtacagatcaccctgactaatact
tctgatcgaaaaatagaaaacatccacataggggggaaagggcttcctgtgggcatgcag
atgcatgcctttcatccaatagactctctggagcctaaggggtccgtgactgtctcagtg
ggtattgacttttgtgattctacacagacggccagtttccaattgtgcaccaaggatgac
tgcttcaacgtcaccctccagccacctgttggggagctgctttcacctgtggccatgtca
gagaaggactttaagaaggagcaaggaacgctcactggaatgaacgagacttcggctaca
ctcatcgctgctccacagaacttcactccctccatgatcctccagaaggttgtaaatgtg
gccaacctcggtgctgtgccttccagccaagataacgtacacaggtttgcagctagaact
gtgcacagtgggtcgctgatgctagtcacagtggaactgaaggaaggctccacagcccag
cttatcatcaacaccgagaaaaccgtgattggttctgttctgctgcgggagctgaagcct
gtcctgtcccaggggtaa

DBGET integrated database retrieval system