KEGG   Mus musculus (house mouse): 11776
Entry
11776             CDS       T01002                                 
Symbol
Ap3d1, AA407035, Ap3d, Bolvr, mBLVR1, mh, mocha
Name
(RefSeq) adaptor-related protein complex 3, delta 1 subunit
  KO
K12396  AP-3 complex subunit delta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11776 (Ap3d1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11776 (Ap3d1)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    11776 (Ap3d1)
 Endosome - Golgi transport
    11776 (Ap3d1)
SSDB
Motif
Pfam: Adaptin_N AP3D1 Cnd1 HEAT_2 PDS5 RTP1_C1 RasGEF_N_2 Vac14_Fab1_bd
Other DBs
NCBI-GeneID: 11776
NCBI-ProteinID: NP_031486
MGI: 107734
Ensembl: ENSMUSG00000020198
UniProt: O54774
Position
10:complement(80542790..80578137)
AA seq 1199 aa
MALKMVKGSIDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAVC
KLTYLQMLGYDISWAAFNIIEVMSASKFTFKRVGYLAASQCFHEGTDVIMLTTNQIRKDL
SSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPES
LRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVLIK
IIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSAS
IQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDDKDESIRLRA
LDLLYGMVSKKNLMEIVKKLMTHVDKAEGTTYRDELLTKIIDICSQSNYQHITNFEWYIS
ILVELTRLEGTRHGHLIAAQMLDVAIRVKAIRKFAVSQMSSLLDSAHLVASSTQRNGICE
VLYAAAWICGEFSEHLQGPQQTLEAMLRPKVTTLPGHIQAVYVQNVVKLYASILQQKEQA
ADTEAAQEVTQLLVERLPQFVQSADLEVQERASCILQLVKHVQKLQAKGVPVAEEVSALF
AGELNPVAPKAQKKVPVPEGLDLDAWINEPPSDSESEDEKPKAIFHEEEPRHTRRRQPEE
DEEELARRREARKQEQANNPFYIKSSPSPQKRYQDAPGVEHIPVVQIDLSVPLKVPGMPM
SDQYVKLEEQRRHRQRLEKDKKRKKKEKGKRRHSSLPTESDEDIAPAQRVDIITEEMPEN
ALPSDEDDKDPNDPYRALDIDLDKPLADSEKLPVQKHRNAEAVKSPEKEGVLGVEKKSKK
PKKKEKKTKEREREKKDKKGEDLDFWLSTTPPPAAAPIPAPSTEELAASTITSPKDECEV
LKGEEEDHVDHDQERKSSRHKKKKHRKEKEKEERPRDKKKAKKKQVAPLENGAAAEEEEE
PIPPMSSYCLLAESPYIKVTYDIQASLQKDSQVTVSIILENQSSSFLKNMELNVLDSLNT
KMTRPEGSSVHDGVPVPFQLPPGVSNEAQFVFTIQSIVMAQKLKGTLSFIAKDDEGATHE
KLDFRLHFSCSSYLITTPCYSDAFAKLLESGDLSMNSIKVDGISMSFQNLLAKICFYHHF
SVVERVDSCASMYSRSIQGHHVCLLVKKGESSVSVDGKCSDATLLSSLLEEMKTTLAQC
NT seq 3600 nt   +upstreamnt  +downstreamnt
atggccctcaagatggtcaagggcagtatcgaccgcatgttcgataagaacctgcaggat
ctggtccgcggcatccgcaaccacaaggaggacgaggccaagtacatctcccagtgcatt
gacgagatcaagcaggagctgaagcaggacaacatcgctgtgaaggccaacgctgtctgc
aagctcacctacttacagatgcttgggtacgacatcagctgggctgccttcaacatcatt
gaagtcatgagtgcctccaagttcacattcaagcgtgttggctaccttgcggcctcccag
tgcttccatgaaggtaccgacgtcatcatgctgaccaccaaccagatccgaaaggacctg
agcagccccagccagtacgacactggagtggcactgactggtctgtcctgttttgtcacc
ccagatcttgccagagacctggcaaatgacatcatgaccctgatgtctcacacgaagccg
tacatcaggaagaaggcagtgctgatcatgtacaaagtattcctcaagtacccagagtcg
ctgcgtcctgcctttccccggcttaaggagaagctggaggacccagacccaggggtacag
tctgcggctgttaatgtcatctgcgagctggcacgccgcaaccctaaaaactacctgtct
ctggcgccactgtttttcaagctcatgacatcctccaccaacaactgggtcctcatcaag
atcatcaagctgttcggtgccctgactcctctggagcccaggctgggcaagaagctgatc
gagcctctcaccaacctcattcacagcacctctgccatgtccctgctgtacgagtgtgtg
aacaccgtaattgctgtgctcatctcactgtcttctgggatgcccaaccacagcgccagc
atccagctatgcgttcagaagttgaggatactgatagaagactccgaccagaacttaaag
tacctggggctgctggccatgtctaaaatcctgaagacacaccccaagtctgtgcagtcc
cacaaggacctgatcctgcagtgcctggatgacaaggacgagtccatccgcctgcgtgca
cttgacctgctctatggaatggtgtccaagaagaacctgatggagattgtgaagaagctc
atgactcacgtggacaaggctgagggcaccacctatcgcgatgaactgctcaccaagatc
attgacatctgtagccagtccaactaccagcacatcaccaacttcgagtggtacatcagc
atccttgtggagctgacaaggctggagggcacccgccatggccacctcattgctgcacag
atgctggacgtggctatccgggtcaaggccattcgcaaatttgctgtgtcgcagatgtcc
tcactgcttgacagtgctcacctggtagccagcagcacccaacgcaatggtatctgtgag
gtgctctatgctgctgcctggatctgcggggagttctcagagcacctacaggggccccag
caaaccctggaggccatgctgcggcccaaggtcaccacactgcccggccatatccaggct
gtgtatgtgcagaacgtggtaaagctgtacgcgtccatcctgcagcagaaggagcaggcc
gctgacactgaggctgcacaagaggtcacccagctactggtggagcgactgccacagttt
gtgcagagcgccgacctggaggtgcaggagcgggcgtcttgcatcctgcagctggtcaag
catgtccagaagctgcaagcaaaaggtgtgccggtggctgaggaagtgagcgccttgttt
gctggtgaactgaaccctgtggcccccaaggctcagaaaaaggtcccagttcctgaaggc
ctagacctggatgcctggatcaatgagccaccttcagacagtgagtctgaggatgagaaa
cccaaggccatcttccatgaagaagagccgaggcacactcggcgccggcagcctgaggag
gatgaagaggagctggctcggcggcgagaggcccggaagcaggaacaagccaacaacccc
ttctacatcaagagctccccatccccgcagaagcgataccaggatgcaccaggtgtggaa
cacattcctgtggtacagatcgacctctcagtgcctctgaaagttccaggtatgcccatg
tcagaccagtatgtgaagctggaggagcagcggcgacaccggcagcggctggagaaggac
aagaaaaggaagaagaaggagaagggcaagcggcgccacagctctctccccacggagagc
gatgaggacattgcccctgcccagcgtgtggacattatcactgaggagatgccagagaat
gctttgcctagtgacgaggatgacaaagaccccaatgacccctacagggcgctggacatt
gacctggataaacccctggctgacagtgagaagctgcctgtccagaaacatagaaatgcg
gaggcggtgaagtccccagagaaggagggtgtgctcggggtagagaagaagagcaagaag
cccaagaagaaggagaagaagaccaaagagagagagagagagaagaaggacaagaagggt
gaggacttagacttctggctgtccaccaccccaccacctgctgctgcccccattcctgcc
ccgtccacggaagaacttgctgcaagcactatcacctcccctaaggatgagtgtgaggtt
ctcaaaggggaagaggaggaccacgtggatcatgaccaagaaaggaaatcatcccggcac
aagaagaagaaacacagaaaggagaaggagaaggaggagaggccacgagacaagaagaaa
gctaagaagaagcaggtggcacctctggagaatggtgcggcagcagaggaggaggaggag
cctatcccgcccatgtccagctactgccttctggctgagagtccctacattaaagtgaca
tatgacatccaagccagcttacagaaggacagccaagtgactgtgtccatcatcctggag
aaccagagcagcagcttcctgaagaacatggagctcaacgtgctggactctctcaacacc
aagatgaccaggccagagggctcatcggtacacgacggtgtgcccgtgcctttccaactg
cctcccggcgtctccaatgaggcccagtttgtgttcaccattcagagcatcgtcatggcc
cagaagctcaaaggcacactgtccttcattgccaaggatgatgaaggagccacccatgag
aagttggacttccggctgcatttcagctgtagctcgtacctgatcaccacaccctgctac
agcgatgcctttgcaaagttgctagagtcaggagacctgagcatgaactccatcaaagtc
gatggcattagtatgtctttccagaatcttctggcaaagatctgcttctaccaccatttt
tccgttgtggagcgagtagactcctgtgcctccatgtacagccgctctatccagggccac
catgtctgcctgctggtgaagaagggcgagagctccgtgtcagtagatgggaagtgcagc
gatgccacgttgctcagcagcctgctggaggaaatgaagaccacgttggctcagtgctga

DBGET integrated database retrieval system