KEGG   Mus musculus (mouse): 11778
Entry
11778             CDS       T01002                                 

Gene name
Ap3s2, [s]3, [s]3B
Definition
(RefSeq) adaptor-related protein complex 3, sigma 2 subunit
  KO
K12399  AP-3 complex subunit sigma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11778 (Ap3s2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11778 (Ap3s2)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    11778 (Ap3s2)
 Endosome - Golgi transport
    11778 (Ap3s2)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 11778
NCBI-ProteinID: NP_033812
MGI: 1337060
Ensembl: ENSMUSG00000063801
Vega: OTTMUSG00000058597
UniProt: Q8BSZ2 Q6PAL3
Position
7; 7 D2
AA seq 193 aa
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSD
YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYIL
QEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIG
DLNIKVPNLSQFV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattcaggcgattctggttttcaacaaccatggaaaaccgcggctggtccgcttctac
cagcgttttccagaagaaattcaacagcagattgttcgagagactttccatctggtcctc
aagcgagatgacaacatctgtaacttcttagaaggtggaagtttgattggtggctctgac
tacaaactgatttaccggcactatgccaccctctactttgtgttttgtgtggattcatca
gagagtgaacttgggatcttggacctcatccaggtttttgtggagacactggataagtgt
tttgagaatgtatgtgagttggacttgatcttccatatggataaggtgcactacatcctg
caggaggtggtgatgggtggaatggtgttggagacaaacatgaatgaaattgtggctcaa
atcgaagctcaaaaccgactggagaagtcggagggcggcctctctgcagctccagcaagg
gccgtgtccgctgtgaagaacatcaacctccctgagatccccaggaacatcaacatcggt
gacctcaacatcaaagtccccaacctgtcccagtttgtgtga

DBGET integrated database retrieval system