KEGG   Mus musculus (mouse): 11782Help
Entry
11782             CDS       T01002                                 

Gene name
Ap4s1, AI314282
Definition
(RefSeq) adaptor-related protein complex AP-4, sigma 1
  KO
K12403  AP-4 complex subunit sigma-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11782 (Ap4s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11782 (Ap4s1)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    11782 (Ap4s1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s
Motif
Other DBs
NCBI-GeneID: 11782
NCBI-ProteinID: NP_068356
MGI: 1337065
Ensembl: ENSMUSG00000020955
UniProt: Q9WVL1
Position
12; 12 B3
AA seq 144 aa AA seqDB search
MIKFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEYKDFKLIYR
QYAALFVVVGVNDTENEMAIYEFIHNFVEVLDGYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKLSES
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagtttttccttatggtgaacaagcaagggcagacccgactgtctaagtactac
gagcatgtggacattaataaacgtgcgcttctggagactgaggtcagcaagagttgcctg
tctcggtccagcgaacaatgctcattcattgaatacaaggattttaaactgatctaccgg
caatatgcagctctctttgttgtggttggagttaatgacactgagaatgagatggctatc
tatgaatttatacacaattttgtggaagttttagatgggtacttcagccgagtgagtgaa
ttagatataatgtttaatttggataaagttcacatcattttggatgagatggtgttaaat
ggctgcattgtggaaactaacagagccagaattcttgcccctctgctgattcttgacaag
ctgtcggaaagctga

DBGET integrated database retrieval system