KEGG   Mus musculus (mouse): 11785
Entry
11785             CDS       T01002                                 

Gene name
Apbb1, Fe65, Rir
Definition
(RefSeq) amyloid beta (A4) precursor protein-binding, family B, member 1
  KO
K04529  amyloid beta A4 precursor protein-binding family B member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11785 (Apbb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11785 (Apbb1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    11785 (Apbb1)
SSDB
Motif
Pfam: PID WW PTB RNA_pol_3_Rpc31 PPP4R2 DNA_pol_phi
Other DBs
NCBI-GeneID: 11785
NCBI-ProteinID: NP_001240814
MGI: 107765
Ensembl: ENSMUSG00000037032
Vega: OTTMUSG00000048248
UniProt: Q9QXJ1 A0A0R4J2C1
Position
7 E3; 7 55.9 cM
AA seq 710 aa
MSVPSSLSQSAINANSHGGPALSFPLPLHAAHNQLLNAKLQATAVVPKDLRSAMGEGSVP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEAETAPLGPKGLMHLYSEL
ELSAHNAANRGLHGSALIINTQEQGPDEGEEKAAGEAEEDDEDEEEEEEEEDLSSPPGLP
EPLENVEVPSGPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHQEGFEEGEFWKDEPSEEAPMELGLKDPEEATLSFPAQSLSPEPVPQEEEKLSQ
RNANPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMAGGWGEGK
DLLLQLEDETLKLVEPQNQTLLHAQPIVSIRVWGVGRDSGRERDFAYVARDKLTQMLKCH
VFRCEAPAKNIATSLHEICSKIMSERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELV
QKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAV
LGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQK
CLDARSQTSTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGSQTP
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgtctgttccatcatccctgagccagtcggccattaacgctaacagccacggaggccct
gcactcagcttccccttacccctgcacgctgcccataaccagctgctcaacgccaagctg
caagccacagctgtggtacccaaggaccttcgaagtgctatgggagagggtagtgtgcct
gaaccaggccctgccaatgccaagtggttaaaggaaggccagaaccagcttcggagggct
gccacagcccaccgagaccagaaccgaaatgtgaccttgaccttggcggaggaggccagc
caggaggctgagacggcacctttgggtcccaaaggcttaatgcatctatactctgagctg
gagctctcggcccacaatgcagccaaccgagggcttcatggatccgccttgatcatcaac
acccaggaacagggaccagatgaaggagaggagaaggcagcaggagaggctgaggaggat
gatgaagacgaagaggaggaggaggaggaggaggacttgtcttctcctccagggctacct
gagcctctggagaatgtggaagtcccctctgggccccaggccctcacagacggcccccgg
gaacacagcaagagtgctagcctcctatttggcatgcgaaacagtgcagccagtgatgag
gactcaagctgggccaccttatcacagggcagcccctcctatggctccccggaggacaca
gattccttctggaaccccaacgctttcgagacggattccgatctaccggctggatggatg
agggtacaggacacctcagggacctactactggcacatcccaacagggaccacccagtgg
gaacccccaggccgggcctccccctcacaggggagcagcccccaagaagagtcccagctc
acctggactggctttgctcaccaagaaggctttgaggaaggagagttttggaaggatgaa
cccagtgaggaggccccaatggagttgggactgaaggaccccgaggaggcgacattgtcc
ttcccagctcagagcctcagcccagaaccagttccccaggaggaagagaagctgtcccaa
cggaatgccaacccagggatcaagtgtttcgctgtgcgctccctaggctgggtagagatg
accgaggaggagctggccccaggacgcagcagtgtggcagtcaacaattgtatccgccag
ctctcctaccacaaaaacaatctacatgatccgatggctgggggctggggagagggaaag
gatctgctgctccagctggaggacgagactctaaagttggtggagccacagaaccagacg
ctgctgcatgcacagcccatcgtcagcattcgtgtgtggggcgttgggcgggacagtgga
agagagagggactttgcctacgtagctcgagataagctgacccagatgctcaagtgccac
gtgtttcgctgtgaggcacctgccaagaacatcgccaccagcctgcatgagatctgctcc
aagatcatgtctgaacggcgcaatgctcgctgcttggtcaatggactctccctagaccac
tctaaactcgtggatgtccctttccaagtggaattcccagcaccaaagaatgagctggtg
cagaagttccaagtctattacctgggaaatgtgccagttgctaaacctgttggggtagac
gtgattaatggggccctggagtcagtcctgtcttccagtagccgtgagcagtggactcca
agtcacgtcagcgtggcccctgccaccctcaccatcttgcaccagcagacagaagcggtg
ctgggggagtgccgggtgcggtttctctccttcctggctgtgggcagagatgtgcacaca
ttcgcgttcatcatggctgccggcccagcctccttctgctgtcacatgttttggtgtgag
cccaatgctgccagtctctcagaggctgtgcaggctgcatgcatgctccgctaccagaag
tgtctggatgctcgctcccagacctccacctcctgcctcccagcaccccctgcggagtca
gttgcaagacgtgtagggtggacagtccgcaggggtgttcagtcgctgtggggttccctc
aagcccaaacgtctgggatcccagaccccatga

DBGET integrated database retrieval system