KEGG   Mus musculus (mouse): 11792Help
Entry
11792             CDS       T01002                                 

Gene name
Apex1, APE, Apex, HAP1, Ref-1
Definition
(RefSeq) apurinic/apyrimidinic endonuclease 1
  KO
K10771  AP endonuclease 1 [EC:4.2.99.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    11792 (Apex1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    11792 (Apex1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     11792 (Apex1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     11792 (Apex1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Motif
Other DBs
NCBI-GeneID: 11792
NCBI-ProteinID: NP_033817
MGI: 88042
Ensembl: ENSMUSG00000035960
Vega: OTTMUSG00000019767
UniProt: P28352 Q544Z7
Position
14 C1; 14 26.3 cM
AA seq 317 aa AA seqDB search
MPKRGKKAAADDGEEPKSEPETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSAT
LKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSA
PSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFESFVLVTAYVPNAGRGLVR
LEYRQRWDEAFRKFLKDLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFG
ELLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIR
SKALGSDHCPITLYLAL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagcggggaaagaaagcggcggccgacgacggggaagaacccaagtcggagcca
gagaccaagaagagtaagggggcagcaaagaaaaccgagaaggaggccgcgggagagggc
cctgtcctgtacgaggaccctccagatcagaaaacctcacccagtggcaaatctgccaca
ctcaagatatgctcctggaatgtggatgggcttcgagcctggattaaaaagaaaggtttg
gattgggtaaaggaagaagcaccagatatcttgtgcctccaagagaccaagtgctcggag
aacaaactcccggctgaactgcaagagctgcctggactcacccatcagtactggtcagct
ccgtcagacaaagaaggatacagtggtgtgggcctactttcccgccagtgcccgctaaaa
gtctcttatggcattggcgaggaagaacatgatcaagaaggccgggtgattgtggctgaa
tttgagtcctttgtcctggtaacagcctatgttcccaatgcaggcaggggtctggtaaga
ctggaataccgacagcgttgggatgaagccttccgaaagtttctaaaggacttggcttcc
agaaagcctcttgtgctatgtggggatctcaatgtggctcatgaagaaattgacctccgt
aaccccaaaggaaacaaaaagaatgctggctttactccccaggagcgccaaggttttggg
gaactgctacaagctgtaccattggctgacagcttccggcatctctaccccaacactgct
tacgcttacactttctggacttacatgatgaatgcccgctctaagaatgttggttggcgc
cttgattactttttgctttcccactctcttttacctgcattgtgtgacagcaagatccgg
tccaaggctcttggcagtgaccactgtcccatcaccctttacctagcactgtga

DBGET integrated database retrieval system