KEGG   Mus musculus (mouse): 11793
Entry
11793             CDS       T01002                                 

Gene name
Atg5, 2010107M05Rik, 3110067M24Rik, AW319544, Ap, Apg5l, Atg5l, C88337, Pad, Paddy
Definition
(RefSeq) autophagy related 5
  KO
K08339  autophagy-related protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04216  Ferroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    11793 (Atg5)
   04136 Autophagy - other
    11793 (Atg5)
   04137 Mitophagy - animal
    11793 (Atg5)
  09143 Cell growth and death
   04216 Ferroptosis
    11793 (Atg5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11793 (Atg5)
   04622 RIG-I-like receptor signaling pathway
    11793 (Atg5)
  09149 Aging
   04211 Longevity regulating pathway
    11793 (Atg5)
   04213 Longevity regulating pathway - multiple species
    11793 (Atg5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11793 (Atg5)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    11793 (Atg5)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    11793 (Atg5)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    11793 (Atg5)
SSDB
Motif
Pfam: APG5
Other DBs
NCBI-GeneID: 11793
NCBI-ProteinID: NP_444299
MGI: 1277186
Ensembl: ENSMUSG00000038160
Vega: OTTMUSG00000063668
UniProt: Q99J83
Position
10 B2; 10 23.24 cM
AA seq 275 aa
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDVSEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
VEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPPEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLREVCPSAVAPEDGEKRSQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIVPQPTD
NT seq 828 nt   +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtgtggtttggacgaattccaacttgcttt
actctctatcaggatgagataactgaaagagaagcagaaccatactatttgcttttgcca
agagtcagctatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagatgttagtgagatatggtttgaatatgaaggcacacccctgaaatggcat
tatccaattggtttactatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtacatttcaagagttttccagaaaaggaccttctacactgtccatccaaggatgcg
gttgaggctcactttatgtcgtgtatgaaagaagctgatgctttaaagcataaaagtcaa
gtgatcaacgaaatgcagaaaaaagaccacaagcagctctggatgggactgcagaatgac
agatttgaccagttttgggccatcaaccggaaactcatggaatatcctccagaagaaaat
ggatttcgttatatcccctttagaatatatcagaccacgacggagcggcctttcatccag
aagctgttccggcctgtggccgcagatggacagctgcacacacttggagatctcctcaga
gaagtctgtccttccgcagtcgcccctgaagatggagagaagaggagccaggtgatgatt
cacgggatagagccaatgctggaaacccctctgcagtggctgagcgagcatctgagctac
ccagataactttcttcatattagcattgtcccccagccaacagattga

DBGET integrated database retrieval system