KEGG   Mus musculus (mouse): 11796Help
Entry
11796             CDS       T01002                                 

Gene name
Birc3, AW107670, Api1, Api2, Birc2, C-IAP2, HIAP2, IAP1, IAP2, MIAP1, MIAP2, MIHB, MIHC, RNF49, cIAP-1, cIAP-2, cIAP1, cIAP2
Definition
(RefSeq) baculoviral IAP repeat-containing 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04510  Focal adhesion
mmu04621  NOD-like receptor signaling pathway
mmu04668  TNF signaling pathway
mmu05145  Toxoplasmosis
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11796 (Birc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    11796 (Birc3)
   04668 TNF signaling pathway
    11796 (Birc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11796 (Birc3)
   04215 Apoptosis - multiple species
    11796 (Birc3)
   04217 Necroptosis
    11796 (Birc3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11796 (Birc3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11796 (Birc3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    11796 (Birc3)
   05202 Transcriptional misregulation in cancer
    11796 (Birc3)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    11796 (Birc3)
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    11796 (Birc3)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    11796 (Birc3)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    11796 (Birc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    11796 (Birc3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    11796 (Birc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 11796
NCBI-ProteinID: NP_031490
MGI: 1197007
Ensembl: ENSMUSG00000032000
Vega: OTTMUSG00000020585
UniProt: O08863 A2CGA5 Q3TSE5
Position
9; 9 A1
AA seq 602 aa AA seqDB search
MNMVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGA
NDKVKCFCCGLMLDNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMST
MPLSFASSENTGYFSGSYSSFPSDPVNFRANQDCPALSTSPYHFAMNTEKARLLTYETWP
LSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQ
SASRYTVSNLSMQTHAARIRTFSNWPSSALVHSQELASAGFYYTGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLLRIKGQEFVSQVQAGYPHLLEQLLSTSDSPEDENADAA
IVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQWQILATGENYRTVSDLVIGLL
DAEDEMREEQMEQAAEEEESDDLALIRKNKMVLFQHLTCVTPMLYCLLSARAITEQECNA
VKQKPHTLQASTLIDTVLAKGNTAATSFRNSLREIDPALYRDIFVQQDIRSLPTDDIAAL
PMEEQLRKLQEERMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTF
LS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggttcaagacagcgcctttctagccaagctgatgaagagtgctgacaccttt
gagttgaagtatgacttttcctgtgagctgtaccgattgtccacgtattcagcttttccc
aggggagttcctgtgtcagaaaggagtctggctcgtgctggcttttactacactggtgcc
aatgacaaggtcaagtgcttctgctgtggcctgatgctagacaactggaaacaaggggac
agtcccatggagaagcacagaaagttgtaccccagctgcaactttgtacagactttgaat
ccagccaacagtctggaagctagtcctcggccttctcttccttccacggcgatgagcacc
atgcctttgagctttgcaagttctgagaatactggctatttcagtggctcttactcgagc
tttccctcagaccctgtgaacttccgagcaaatcaagattgtcctgctttgagcacaagt
ccctaccactttgcaatgaacacagagaaggccagattactcacctatgaaacatggcca
ttgtcttttctgtcaccagcaaagctggccaaagcaggcttctactacataggacctgga
gatagagtggcctgctttgcgtgcgatgggaaactgagcaactgggaacgtaaggatgat
gctatgtcagagcaccagaggcatttccccagctgtccgttcttaaaagacttgggtcag
tctgcttcgagatacactgtctctaacctgagcatgcagacacacgcagcccgtattaga
acattctctaactggccttctagtgcactagttcattcccaggaacttgcaagtgcgggc
ttttattatacaggacacagtgatgatgtcaagtgtttttgctgtgatggtgggctgagg
tgctgggaatctggagatgacccctgggtggaacatgccaagtggtttccaaggtgtgag
tacttgctcagaatcaaaggccaagaatttgtcagccaagttcaagctggctatcctcat
ctacttgagcagctattatctacgtcagactccccagaagatgagaatgcagacgcagca
atcgtgcattttggccctggagaaagttcggaagatgtcgtcatgatgagcacgcctgtg
gttaaagcagccttggaaatgggcttcagtaggagcctggtgagacagacggttcagtgg
cagatcctggccactggtgagaactacaggaccgtcagtgacctcgttataggcttactc
gatgcagaagacgagatgagagaggagcagatggagcaggcggccgaggaggaggagtca
gatgatctagcactaatccggaagaacaaaatggtgcttttccaacatttgacgtgtgtg
acaccaatgctgtattgcctcctaagtgcaagggccatcactgaacaggagtgcaatgct
gtgaaacagaaaccacacaccttacaagcaagcacactgattgatactgtgttagcaaaa
ggaaacactgcagcaacctcattcagaaactcccttcgggaaattgaccctgcgttatac
agagatatatttgtgcaacaggacattaggagtcttcccacagatgacattgcagctcta
ccaatggaagaacagttgcggaaactccaggaggaaagaatgtgtaaagtgtgtatggac
cgagaggtatccatcgtgttcattccctgtggccatctggtcgtgtgcaaagactgcgct
ccctctctgaggaagtgtcccatctgtagagggaccatcaagggcacagtgcgcacattt
ctctcctga

DBGET integrated database retrieval system