KEGG   Mus musculus (mouse): 11799
Entry
11799             CDS       T01002                                 

Gene name
Birc5, A, AAC-11, Api4, T, TIAP, s, survivin40
Definition
(RefSeq) baculoviral IAP repeat-containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04390  Hippo signaling pathway
mmu05161  Hepatitis B
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    11799 (Birc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11799 (Birc5)
   04215 Apoptosis - multiple species
    11799 (Birc5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11799 (Birc5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    11799 (Birc5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    11799 (Birc5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    11799 (Birc5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11799 (Birc5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    11799 (Birc5)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I32: IAP family
   11799 (Birc5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     11799 (Birc5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    11799 (Birc5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 11799
NCBI-ProteinID: NP_033819
MGI: 1203517
Ensembl: ENSMUSG00000017716
Vega: OTTMUSG00000003737
UniProt: O70201 Q549P2
Structure
PDB: 
1M4M

Position
11; 11 E2
AA seq 140 aa
MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNK
QKEFEETAKTTRQSIEQLAA
NT seq 423 nt   +upstreamnt  +downstreamnt
atgggagctccggcgctgccccagatctggcagctgtacctcaagaactaccgcatcgcc
accttcaagaactggcccttcctggaggactgcgcctgcaccccagagcgaatggcggag
gctggcttcatccactgccctaccgagaacgagcctgatttggcccagtgttttttctgc
tttaaggaattggaaggctgggaacccgatgacaacccgatagaggagcatagaaagcac
tcccctggctgcgccttcctcactgtcaagaagcagatggaagaactaaccgtcagtgaa
ttcttgaaactggacagacagagagccaagaacaaaattgcaaaggagaccaacaacaag
caaaaagagtttgaagagactgcaaagactacccgtcagtcaattgagcagctggctgcc
taa

DBGET integrated database retrieval system