KEGG   Mus musculus (mouse): 11801Help
Entry
11801             CDS       T01002                                 

Gene name
Cd5l, 1/6, AAC-11, AI047839, Api6, CT2, Pdp, Sp-alpha, mAIM
Definition
(RefSeq) CD5 antigen-like
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SRCR SRCR_2 Hepsin-SRCR
Motif
Other DBs
NCBI-GeneID: 11801
NCBI-ProteinID: NP_033820
MGI: 1334419
Ensembl: ENSMUSG00000015854
Vega: OTTMUSG00000051776
UniProt: Q9QWK4
Position
3; 3 F1
AA seq 352 aa AA seqDB search
MAPLFNLMLAILSIFVGSCFSESPTKVQLVGGAHRCEGRVEVEHNGQWGTVCDDGWDRRD
VAVVCRELNCGAVIQTPRGASYQPPASEQRVLIQGVDCNGTEDTLAQCELNYDVFDCSHE
EDAGAQCENPDSDLLFIPEDVRLVDGPGHCQGRVEVLHQSQWSTVCKAGWNLQVSKVVCR
QLGCGRALLTYGSCNKNTQGKGPIWMGKMSCSGQEANLRSCLLSRLENNCTHGEDTWMEC
EDPFELKLVGGDTPCSGRLEVLHKGSWGSVCDDNWGEKEDQVVCKQLGCGKSLHPSPKTR
KIYGPGAGRIWLDDVNCSGKEQSLEFCRHRLWGYHDCTHKEDVEVICTDFDV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctccattgttcaacttgatgctggccatcttgagcatttttgttggatcgtgtttt
tcagagtctccaaccaaagtgcagctagtgggaggtgcccaccgctgtgaagggcgagtg
gaggtggaacacaatggccagtgggggactgtgtgtgatgatggctgggaccggcgtgat
gtggctgtggtgtgccgagagctcaattgtggagcagtcatccaaaccccgcgtggcgca
tcatatcagccaccagcatcagagcaaagagttcttattcaaggggttgactgcaacgga
acggaagacacgttggctcaatgtgagctaaattacgatgtttttgactgctcacatgaa
gaagatgctggggcacagtgtgagaacccagacagtgacctcctcttcattccagaggat
gtgcgtctagtagatggcccggggcactgccagggtcgagtggaggtgctccaccagtcc
cagtggagcactgtgtgtaaagcaggctggaacttacaggtctcaaaggtggtgtgcagg
cagctcgggtgtgggcgggcattactgacctacggaagctgcaacaagaatactcagggc
aaaggacccatctggatgggcaagatgtcgtgttctggacaagaagcaaaccttcggtct
tgccttttgagtcgtttggagaacaactgtacccatggcgaggacacatggatggaatgt
gaagatccttttgagctgaagctggtgggaggagacaccccctgctctgggaggttggag
gtgctacacaagggttcctggggctctgtctgtgatgacaactggggagaaaaggaggac
caagtggtctgcaagcaactgggttgtgggaagtccctccatccatcccccaaaacccgg
aaaatctatgggcctggggcaggccgcatctggctggatgacgtcaactgctcagggaag
gaacagtctctggagttctgccggcacaggttgtgggggtaccacgactgtacccacaag
gaagatgtggaggtgatctgcacagactttgatgtgtga

DBGET integrated database retrieval system