KEGG   Mus musculus (mouse): 11803Help
Entry
11803             CDS       T01002                                 

Gene name
Aplp1
Definition
(RefSeq) amyloid beta (A4) precursor-like protein 1
  KO
K05639  amyloid-like protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    11803 (Aplp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APP_E2 APP_N APP_Cu_bd APP_amyloid IFRD HXXSHH
Motif
Other DBs
NCBI-GeneID: 11803
NCBI-ProteinID: NP_031493
MGI: 88046
Ensembl: ENSMUSG00000006651
Vega: OTTMUSG00000059360
UniProt: Q03157 A0A0R4IZZ1 Q3TUB1
Position
7 B1; 7 18.32 cM
AA seq 654 aa AA seqDB search
MGPTSPAARGQGRRWRPPPLPLLLPLSLLLLRAQLAVGNLAVGSPSAAEAPGSAQVAGLC
GRLTLHRDLRTGRWEPDPQRSRRCLLDPQRVLEYCRQMYPELHIARVEQAAQAIPMERWC
GGTRSGRCAHPHHEVVPFHCLPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEA
CSSQGLILHGSGMLLPCGSDRFRGVEYVCCPPPATPNPSGMAAGDPSTRSWPLGGRAEGG
EDEEEVESFPQPVDDYFVEPPQAEEEEEEEEERAPPPSSHTPVMVSRVTPTPRPTDGVDV
YFGMPGEIGEHEGFLRAKMDLEERRMRQINEVMREWAMADSQSKNLPKADRQALNEHFQS
ILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQGDPPQAERVLMALRRY
LRAEQKEQRHTLRHYQHVAAVDPEKAQQMRFQVQTHLQVIEERMNQSLGLLDQNPHLAQE
LRPQIQELLLAEHLGPSELDASVPGSSSEDKGSLQPPESKDDPPVTLPKGSTDQESSSSG
REKLTPLEQYEQKVNASAPRGFPFHSSDIQRDELAPSGTGVSREALSGLLIMGAGGGSLI
VLSLLLLRKKKPYGTISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLEERP
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggggcccaccagccccgccgctcgcggtcagggtcgccgctggcgaccgccgccgctg
ccgctgttgctgccactgtcattgctgcttctgcgcgcgcagctcgccgtcgggaacctg
gctgttgggagccccagcgcggccgaggctccggggtcggctcaagtggctggactatgt
gggcgtctaacccttcaccgggacctgcgcaccggccgctgggaaccagacccacagcga
tcacgacgctgtcttctggacccgcagcgcgtgctggagtactgcagacagatgtacccc
gagctgcacatagcacgcgtggagcaggctgcacaggccatcccgatggagcgctggtgt
gggggtacccggagtggcagatgcgcccacccccaccatgaggttgtgcccttccattgc
ctgcctggcgaattcgtgagtgaagccctgctagtgcccgaaggctgtcggttcttgcac
caggagcgtatggaccagtgtgagagttcaaccaggaggcatcaggaggctcaggaggcc
tgcagctctcagggcctcatcctgcatggctctggcatgcttttgccctgtggctctgat
cggttccgaggtgtggagtatgtatgctgtccacctcctgcaactcccaacccatctggg
atggcagctggtgacccctctacccggtcctggcccctggggggcagagcagagggaggt
gaggatgaagaggaggtggaatctttccctcagccagtagacgattacttcgtagagccc
cctcaggctgaagaagaagaggaagaggaggaagaaagggccccacctcccagctcccac
acccctgtcatggttagcagagtcactcccaccccaaggcctactgatggtgtggatgtt
tactttggcatgcctggggaaatcggcgagcatgagggtttcctgagggccaagatggac
ctggaggagcgtaggatgcgccagattaatgaggtgatgcgtgaatgggccatggctgac
agccaatctaagaacctgccaaaggcggacaggcaggccctgaatgagcacttccagtcc
attctgcagaccctggaagaacaagtgtctggtgaacggcaacgcctggtggagacccac
gccaccagagtcatcgctctgatcaacgaccagcgccgagcagccctggaaggtttcctg
gcagccttacagggcgatccgcctcaggctgagcgagttctgatggccctgaggcgctac
ctgcgcgccgagcagaaagagcagaggcacactctgaggcactaccagcacgtggccgca
gtggatcctgagaaggcccagcagatgcgctttcaggtccagacccaccttcaggtgatc
gaagagcgaatgaatcagagcctggggctgctcgaccagaaccctcacctggctcaggag
ctgcggccacagatccaggagcttctccttgctgaacacttgggtcccagtgaactggac
gcctctgtgcccgggagcagcagtgaggacaaaggtagcctccagcctcccgaatccaag
gacgatcccccagtgacccttccaaaagggtccacagatcaagagtcatcctcctctggg
agagagaagctaactccactggagcagtatgagcaaaaggtgaatgcatccgccccgagg
gggtttcccttccactcgtcagatatccagcgggatgaactggctccttccgggactgga
gtgtcccgagaggccttgtcaggtctgctgatcatgggagctggaggaggctccctcatt
gtcctatccttgctgcttctgcgcaagaagaaaccctatgggactatcagccatggagtg
gtggaggtggaccccatgctgaccctggaggagcagcagctccgggaacttcagaggcat
ggctatgagaaccccacctaccgcttcctggaagaacgaccttga

DBGET integrated database retrieval system