KEGG   Mus musculus (mouse): 11804Help
Entry
11804             CDS       T01002                                 

Gene name
Aplp2, AI790698, APLP-2, CDEBP
Definition
(RefSeq) amyloid beta (A4) precursor-like protein 2
  KO
K08117  amyloid-like protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    11804 (Aplp2)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   11804 (Aplp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APP_E2 APP_N APP_amyloid APP_Cu_bd VHL_C Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 11804
NCBI-ProteinID: NP_001095926
MGI: 88047
Ensembl: ENSMUSG00000031996
Vega: OTTMUSG00000062829
UniProt: Q06335
Position
9 A4; 9 16.66 cM
AA seq 707 aa AA seqDB search
MAATGTAAAAATGKLLVLLLLGLTAPAAALAGYIEALAANAGTGFAVAEPQIAMFCGKLN
MHVNIQTGKWEPDPTGTKSCLGTKEEVLQYCQEIYPELQITNVMEANQPVNIDSWCRRDK
RQCKSHIVIPFKCLVGEFVSDVLLVPDNCQFFHQERMEVCEKHQRWHTLVKEACLTEGLT
LYSYGMLLPCGVDQFHGTEYVCCPQTKTVDSDSTMSKEEEEEEEDEEDEEEDYDLDKSEF
PTEADLEDFTEAAADEEEEDEEEGEEVVEDRDYYYDPFKGDDYNEENPTEPSSEGTISDK
EIVHDVKVPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAE
LQAKNLPKTERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRIALENYL
AALQSDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVI
EERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQFTSSISENPVDVRVSSEESEEI
PPFHPLHPFPSLSENEDTQPELYHPMKKGSGMAEQDGGLIGAEEKVINSKNKMDENMVID
ETLDVKEMIFNAERVGGLEEEPESVGPLREDFSLSSNALIGLLVIAVAIATVIVISLVML
RKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccgggaccgcggccgctgcggccaccggcaagcttcttgtcctgctgctg
ctcgggctcacggcgcccgctgcggctctggctggctacatagaggctcttgcagccaat
gctggaacaggcttcgctgttgctgagcctcagattgcgatgttctgtgggaagctgaat
atgcatgtgaacattcagactggcaaatgggagcctgacccaacaggcaccaagagctgc
cttggaacaaaggaggaggttcttcagtactgccaggagatatatccagagctgcagatc
acaaatgtgatggaagcaaaccagccagtcaatattgatagttggtgccgaagggacaaa
aggcagtgcaagagtcacattgttataccattcaagtgtcttgtgggtgaatttgtaagt
gatgtcctgctagttccagataactgccagtttttccaccaagagcggatggaggtgtgt
gagaagcaccagcgctggcacacgttagtcaaggaggcatgtctgactgaggggctgacc
ttatatagctatggcatgctgctgccctgcggggtagaccagttccatggcaccgagtat
gtgtgctgccctcagacaaagactgttgactcggactcgactatgtccaaagaagaggag
gaagaggaagaggatgaagaggacgaagaggaagactatgatcttgataaaagtgaattt
cctactgaagcagatttggaagacttcacagaagcagcagcagatgaggaagaagaggat
gaggaggaaggggaggaagtggtggaagaccgtgactactactatgacccctttaaagga
gacgattacaatgaggagaatccaaccgaacccagcagcgagggcaccatttcagacaag
gagattgttcacgatgttaaagttcccccgactcccctgccaaccaatgatgttgatgtg
tattttgagacctcagcggatgataatgagcacgcccgcttccagaaggctaaggaacag
ctggaaattcgacatcgaaaccgaatggacagggtaaagaaggaatgggaagaggcagaa
cttcaagccaagaacctccccaagacagaaagacagaccctcatccagcatttccaagct
atggttaaagctttagagaaagaagcagccagtgagaagcagcagcttgtggaaacccat
ctggcccgagtagaagccatgctgaatgaccgccgacgcatagctctggaaaattacctg
gctgccctgcagtctgacccacctcggccacatcgcattcttcaagctcttcgtcgttac
gtccgtgctgagaacaaagatcgcctgcataccattcgtcattaccaacacgtgttggct
gttgacccagaaaaggccgcccagatgaaatcccaggtgatgacacacctccatgtgatt
gaagaaagaaggaaccaaagtctttctcttctgtacaaagttccttatgttgctcaagaa
attcaagaggaaattgatgagctccttcaggaacagcgagcggatatggaccaatttacc
tcctccatctcagagaaccctgtggatgtccgggtgagctctgaggagagtgaggagatc
ccgccgttccaccctctccatcccttcccatccttgtctgagaatgaagacactcagccg
gagttgtaccacccaatgaaaaaaggctctggaatggcagaacaagacgggggactgatt
ggtgcagaagaaaaagtgattaacagcaagaataaaatggatgaaaatatggtcattgac
gagactctggatgttaaggaaatgattttcaatgctgagagagttggaggccttgaggaa
gagccggaatcggtgggacctttaagggaggatttcagtttgagcagcaatgcccttatt
ggcttgctggttatcgcagtggccattgctacggtcatcgttatcagcctggtgatgctg
aggaagaggcagtacggcaccatcagccacgggattgtggaggttgacccaatgctcacc
ccagaagagcgtcacctgaacaagatgcagaaccatggttatgaaaacccaacctacaaa
tacctggagcagatgcagatttaa

DBGET integrated database retrieval system