KEGG   Mus musculus (mouse): 11806
Entry
11806             CDS       T01002                                 

Gene name
Apoa1, Al, Alp-1, Ap, Apoa-1, Brp-, Brp-14, Ltw-, Ltw-1, Lvtw, Lvtw-1, Se, Sep, Sep-1, Sep-2, Sep2, apo-AI, apoA-I
Definition
(RefSeq) apolipoprotein A-I
  KO
K08757  apolipoprotein A-I
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04975  Fat digestion and absorption
mmu04977  Vitamin digestion and absorption
mmu04979  Cholesterol metabolism
mmu05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    11806 (Apoa1)
  09154 Digestive system
   04975 Fat digestion and absorption
    11806 (Apoa1)
   04979 Cholesterol metabolism
    11806 (Apoa1)
   04977 Vitamin digestion and absorption
    11806 (Apoa1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    11806 (Apoa1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11806 (Apoa1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   11806 (Apoa1)
SSDB
Motif
Pfam: Apolipoprotein YtxH ApoLp-III DUF1640 Baculo_PEP_C DHC_N1 KMP11 OmpH Exonuc_VII_L BshC DUF445 Lant_dehydr_C TMF_TATA_bd TPD52 SF-assemblin Diphtheria_T DUF2884 PnpCD_PnpD_N Octopine_DH DcpS_C DNA_primase_S ATPase ACP_PD Prominin HIP1_clath_bdg
Other DBs
NCBI-GeneID: 11806
NCBI-ProteinID: NP_033822
MGI: 88049
Ensembl: ENSMUSG00000032083
Vega: OTTMUSG00000028707
UniProt: Q00623
Structure
PDB: 
2LEM

Position
9 A5.2; 9 25.36 cM
AA seq 264 aa
MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSS
LGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKV
QPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVD
SLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLM
PMLETLKTQVQSVIDKASETLTAQ
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaaagctgtggtgctggccgtggctctggtcttcctgacagggagccaggcttggcac
gtatggcagcaagatgaaccccagtcccaatgggacaaagtgaaggatttcgctaatgtg
tatgtggatgcggtcaaagacagcggcagagactatgtgtcccagtttgaatcctcctcc
ttgggccaacagctgaacctgaatctcctggaaaactgggacactctgggttcaaccgtt
agtcagctgcaggaacggctgggcccattgactcgggacttctgggataacctggagaaa
gaaacagattgggtgagacaggagatgaacaaggacctagaggaagtgaaacagaaggtg
cagccctacctggacgaattccagaagaaatggaaagaggatgtggagctctaccgccag
aaggtggcgcctctgggcgccgagctgcaggagagcgcgcgccagaagctgcaggagctg
caagggagactgtcccctgtggctgaggaatttcgcgaccgcatgcgcacacacgtagac
tctctgcgcacacagctagcgccccacagcgaacagatgcgcgagagcctggcccagcgc
ctggctgagctcaagagcaaccctaccttgaacgagtaccacaccagggccaaaacccac
ctgaagacacttggcgagaaagccagacctgcgctggaggacctgcgccatagtctgatg
cccatgctggagacgcttaagacccaagtccagagtgtgatcgacaaggccagcgagact
ctgactgcccagtga

DBGET integrated database retrieval system