KEGG   Mus musculus (mouse): 11807Help
Entry
11807             CDS       T01002                                 

Gene name
Apoa2, Alp-2, Apo-AII, ApoA-II, ApoAII, Apoa-2, Hdl-1
Definition
(RefSeq) apolipoprotein A-II
  KO
K08758  apolipoprotein A-II
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    11807 (Apoa2)
  09154 Digestive system
   04979 Cholesterol metabolism
    11807 (Apoa2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11807 (Apoa2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   11807 (Apoa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ApoA-II
Motif
Other DBs
NCBI-GeneID: 11807
NCBI-ProteinID: NP_001292478
MGI: 88050
Ensembl: ENSMUSG00000005681
Vega: OTTMUSG00000021666
UniProt: P09813
Position
1 H3; 1 79.22 cM
AA seq 102 aa AA seqDB search
MKLLAMVALLVTICSLEGALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQ
AKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctcgcaatggtcgcactgctggtcaccatctgtagcctggaaggagctttg
gttaagagacaggcagacggaccggatatgcagagcctgttcactcaatactttcagagc
atgactgattatggcaaagatttgatggagaaggccaagacctcagagattcagagccag
gccaaggcatactttgagaagacacacgagcagctgacaccccttgtcaggtcagcagga
actagtctggtgaacttcttcagcagtttaatgaaccttgaggagaaaccggctcctgcg
gctaagtga

DBGET integrated database retrieval system