KEGG   Mus musculus (mouse): 11813
Entry
11813             CDS       T01002                                 

Gene name
Apoc2, apo-CII, apoC-II
Definition
(RefSeq) apolipoprotein C-II
  KO
K22287  apolipoprotein C-II
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    11813 (Apoc2)
SSDB
Motif
Pfam: Apo-CII
Other DBs
NCBI-GeneID: 11813
NCBI-ProteinID: NP_001264873
MGI: 88054
Ensembl: ENSMUSG00000002992
Vega: OTTMUSG00000032974
UniProt: Q05020 Q3UJG0
Position
7 A3; 7 9.94 cM
AA seq 97 aa
MGSRFFLALFLVILMLGNEVQGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTY
PISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE
NT seq 294 nt   +upstreamnt  +downstreamnt
atggggtctcggttcttcctggctctattcctggtcatcctgatgttgggaaatgaggtc
caggggaaccaggaagatgactcgggcagcctggctctgctgggcacggtgcagggctcc
ctcttaagttactggacctctgccaaggaggttgccaaagacctgtaccagaagacatac
ccgatcagcatggatgagaaactcagggacatgtacagcaaaagctcggcggccatgagc
acttacgcaggcatttttacagaccagctccttactctcctgaggggagagtag

DBGET integrated database retrieval system