KEGG   Mus musculus (mouse): 11816Help
Entry
11816             CDS       T01002                                 

Gene name
Apoe, AI255918, Apo-E
Definition
(RefSeq) apolipoprotein E
  KO
K04524  apolipoprotein E
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04979  Cholesterol metabolism
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    11816 (Apoe)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11816 (Apoe)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11816 (Apoe)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    11816 (Apoe)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   11816 (Apoe)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Others
   11816 (Apoe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein DUF883 ApoLp-III GldM_N DUF1690 PIN_8 DUF1664 CAP_N DUF1043 PrkA Phasin OmpH Prominin AKNA DIT1_PvcA DUF1451 Stathmin
Motif
Other DBs
NCBI-GeneID: 11816
NCBI-ProteinID: NP_001292748
MGI: 88057
Ensembl: ENSMUSG00000002985
Vega: OTTMUSG00000038239
UniProt: P08226 Q3TXU4
Structure
PDB: 

Position
7 A3; 7 9.94 cM
AA seq 311 aa AA seqDB search
MKALWAVLLVTLLTGCLAEGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEE
LQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMED
LRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGA
ERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLE
EVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATN
PIITPVAQENQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctgtgggccgtgctgttggtcacattgctgacaggatgcctagccgaggga
gagccggaggtgacagatcagctcgagtggcaaagcaaccaaccctgggagcaggccctg
aaccgcttctgggattacctgcgctgggtgcagacgctgtctgaccaggtccaggaagag
ctgcagagctcccaagtcacacaagaactgacggcactgatggaggacactatgacggaa
gtaaaggcttacaaaaaggagctggaggaacagctgggtccagtggcggaggagacacgg
gccaggctgggcaaagaggtgcaggcggcacaggcccgactcggagccgacatggaggat
ctacgcaaccgactcgggcagtaccgcaacgaggtgcacaccatgctgggccagagcaca
gaggagatacgggcgcggctctccacacacctgcgcaagatgcgcaagcgcttgatgcgg
gatgccgaggatctgcagaagcgcctagctgtgtacaaggcaggggcacgcgagggcgcc
gagcgcggtgtgagtgccatccgtgagcgcctggggcctctggtggagcaaggtcgccag
cgcactgccaacctaggcgctggggccgcccagcctctgcgcgatcgcgcccaggctttt
ggtgaccgcatccgagggcggctggaggaagtgggcaaccaggcccgtgaccgcctagag
gaggtgcgtgagcacatggaggaggtgcgctccaagatggaggaacagacccagcaaata
cgcctgcaggcggagatcttccaggcccgcctcaagggctggttcgagccaatagtggaa
gacatgcatcgccagtgggcaaacctgatggagaagatacaggcctctgtggctaccaac
cccatcatcaccccagtggcccaggagaatcaatga

DBGET integrated database retrieval system