KEGG   Mus musculus (mouse): 11820
Entry
11820             CDS       T01002                                 

Gene name
App, A, Abe, Abeta, Abpp, Adap, Ag, C, Cvap, E030013M08Rik, bet, betaApp
Definition
(RefSeq) amyloid beta (A4) precursor protein
  KO
K04520  amyloid beta A4 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04726  Serotonergic synapse
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    11820 (App)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11820 (App)
   05022 Pathways of neurodegeneration - multiple diseases
    11820 (App)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11820 (App)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    11820 (App)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    11820 (App)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   11820 (App)
Proteoglycans [BR:mmu00535]
 Cell surface proteoglycans
  Others
   11820 (App)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Others
   11820 (App)
SSDB
Motif
Pfam: APP_E2 APP_N APP_Cu_bd APP_amyloid Beta-APP Kunitz_BPTI Ints3 Insulin_TMD Spore_III_AB
Other DBs
NCBI-GeneID: 11820
NCBI-ProteinID: NP_001185752
MGI: 88059
Ensembl: ENSMUSG00000022892
UniProt: P12023 Q6GR78 Q3TWF3
Structure
PDB: 
4YN0

Position
16 C3.3; 16 46.92 cM
AA seq 770 aa
MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTK
TCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEE
EADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCVPFFYGGCGGNRNNFDTEEYCMAVCGSVSTQSLLKTTSEPLPQD
PDKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgctgcccagcttggcactgctcctgctggccgcctggacggttcgggctctggaggta
cccactgatggcaacgccgggctgctggcagaaccccagatcgccatgttctgtggtaaa
ctcaacatgcacatgaatgtgcagaatggaaagtgggagtcagacccgtcagggaccaaa
acctgcattggcaccaaggagggcatcttgcagtactgccaagaggtctaccctgaactg
cagatcacaaacgtggtggaagccaaccagccagtgaccatccagaactggtgcaagcgg
ggccgcaagcagtgcaagacacacacccacatcgtgattccttaccgttgcctagttggt
gagtttgtgagcgacgcccttctcgtgcccgacaagtgcaagttcctacaccaggagcgg
atggatgtttgtgagacccatcttcactggcacaccgtcgccaaagagacatgcagcgag
aagagcactaacttgcacgactatggcatgctgctgccctgcggcatcgacaagttccga
ggggtagagtttgtatgctgcccgttggccgaggaaagcgacagcgtggattctgcggat
gcagaggaggatgactctgatgtctggtggggtggagcggacacagactacgctgatggc
ggtgaagacaaagtagtagaagtcgccgaagaggaggaagtggctgatgttgaggaagag
gaagctgatgatgatgaggatgtggaggatggggacgaggtggaggaggaggccgaggag
ccctacgaagaggccaccgagagaacaaccagcactgccaccaccaccacaaccaccact
gagtccgtggaggaggtggtccgagaggtgtgctctgaacaagccgagaccgggccatgc
cgcgcaatgatctcccgctggtactttgatgtcactgaagggaagtgtgtcccattcttt
tacggcggatgtggcggcaacaggaacaactttgacacggaagagtactgcatggcggtg
tgtggcagcgtgtcaacccaaagtttactcaagactaccagtgaacctcttccccaagat
cctgataaacttcccacgacagcagccagcacccccgacgccgtcgacaagtacctggag
acacccggggacgagaacgagcatgcccatttccagaaagccaaagagaggctggaagcc
aagcaccgagagagaatgtcccaggtcatgagagaatgggaagaggcagagcgtcaagcc
aagaacttgcccaaagctgacaagaaggccgttatccagcatttccaggagaaagtggaa
tctctggaacaggaagcagccaatgagagacagcagcttgtagagacacacatggccaga
gttgaagccatgctcaatgaccgccgccgcctggccctcgagaattacatcactgcactg
caggcggtgcccccaaggcctcatcatgtgttcaacatgctgaagaagtacgtccgtgcg
gagcagaaagacagacagcacaccctaaagcattttgaacatgtgcgcatggtggacccc
aagaaagctgctcagatccggtcccaggttatgacacacctccgtgtgatctacgagcgc
atgaaccagtctctgtccctgctctacaatgtccctgcggtggctgaggagattcaagat
gaagtcgatgagctgcttcagaaggagcagaactactccgacgatgtcttggccaacatg
atcagtgagcccagaatcagctacggaaacgacgctctcatgccttcgctgacggaaacc
aagaccaccgtggagctccttcccgtgaatggggaattcagcctggatgacctccagccg
tggcacccttttggggtggactctgtgccagccaataccgaaaatgaagtcgagcctgtt
gacgcccgccccgctgctgaccgaggactgaccactcgaccaggttctgggctgacaaac
atcaagacggaagagatctcggaagtgaagatggatgcagaattcggacatgattcagga
tttgaagtccgccatcaaaaactggtgttctttgctgaagatgtgggttcgaacaaaggc
gccatcatcggactcatggtgggcggcgttgtcatagcaaccgtgattgtcatcaccctg
gtgatgttgaagaagaaacagtacacatccatccatcatggcgtggtggaggtcgacgcc
gccgtgaccccagaggagcgccatctctccaagatgcagcagaacggatatgagaatcca
acttacaagttctttgagcaaatgcagaactaa

DBGET integrated database retrieval system