KEGG   Mus musculus (mouse): 11821Help
Entry
11821             CDS       T01002                                 

Gene name
Aprt, C85684
Definition
(RefSeq) adenine phosphoribosyl transferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11821 (Aprt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11821 (Aprt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     11821 (Aprt)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11821 (Aprt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran PRTase_2 UPRTase
Motif
Other DBs
NCBI-GeneID: 11821
NCBI-ProteinID: NP_033828
MGI: 88061
Ensembl: ENSMUSG00000006589
Vega: OTTMUSG00000061857
UniProt: P08030
Position
8 E1; 8 71.91 cM
AA seq 180 aa AA seqDB search
MSEPELKLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRLLASHLKSTHSGKIDY
IAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLEYGKAELEIQKDALEPG
QRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLVELTSLKGRERLGPIPFFSLLQYD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacctgagttgaaactggtggcgcggcgcatccgcagcttccccgacttccca
atcccgggcgtgctgttcagggatatctcgcccctcttgaaagacccggactccttccga
gcttccatccgcctcttggccagtcacctgaagtccacgcacagcggcaagatcgactac
atcgcaggtctagactccaggggcttcctgtttggcccttccctagctcaggagctgggc
gtgggctgtgtgctcatccggaaacaggggaagctgccgggccccactgtgtcagcctcc
tattctctggagtatgggaaggctgagctggaaatccagaaagatgccttggaacccggg
cagagagtggtcattgtggatgacctcctggccacaggaggaaccatgtttgcggcctgt
gacctgctgcaccagctccgggctgaagtggtggagtgtgtgagcctggtggagctgacc
tcgctgaagggcagggagaggctaggacctataccattcttctctctcctccagtatgac
tga

DBGET integrated database retrieval system