KEGG   Mus musculus (mouse): 11828
Entry
11828             CDS       T01002                                 

Gene name
Aqp3, AQP-2
Definition
(RefSeq) aquaporin 3
  KO
K09876  aquaporin-3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    11828 (Aqp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11828 (Aqp3)
Transporters [BR:mmu02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    11828 (Aqp3)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 11828
NCBI-ProteinID: NP_057898
MGI: 1333777
Ensembl: ENSMUSG00000028435
Vega: OTTMUSG00000006621
UniProt: Q8R2N1
Position
4; 4 A5
AA seq 292 aa
MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN
LAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVF
GLYYDAIWAFANNELFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVD
PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGR
HWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSTEEENVKLAHMKHKEQI
NT seq 879 nt   +upstreamnt  +downstreamnt
atgggtcgacagaaggagttgatgaatcgttgtggggagatgcttcacatccgctaccgg
ctgcttcgccaggcgctggcggagtgcctggggaccctcatccttgtgatgtttggctgt
ggctccgtggctcaggtggtgctcagccgtggcacccatggtggcttcctcaccatcaac
ttggcttttggcttcgctgtcacccttggcatcttggtggctggccaggtgtctggtgcc
cacttgaaccccgctgtgaccttcgcaatgtgcttcctggcacgagagccctggatcaag
ctgcccatctatgcactggcacagacactgggggccttcttgggcgctgggattgttttt
gggctgtactacgatgcaatctgggcctttgccaacaatgagcttttcgtctctggcccc
aacggcacagctggaatctttgccacctatccctctggacacttggacatggtcaatggc
ttctttgatcagttcataggcacagccgcccttattgtgtgtgtactggccatcgttgac
ccttataacaaccctgtgccccgtggcctggaggctttcactgtgggcctggtggtcctg
gtcattggaacctccatgggcttcaattctggctatgccgtcaaccctgcccgtgacttt
ggacctcgcctcttcaccgccctggctggctggggctcagaagtcttcacgactggccgg
cactggtggtgggtacccattgtctccccactcctgggttccatcgctggtgtcttcgtg
taccagctcatgattggttgccacctggagcagcccccaccctccaccgaggaagagaat
gtgaagctggcccacatgaaacacaaggagcagatctga

DBGET integrated database retrieval system