KEGG   Mus musculus (mouse): 11830Help
Entry
11830             CDS       T01002                                 

Gene name
Aqp5
Definition
(RefSeq) aquaporin 5
  KO
K09867  aquaporin-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    11830 (Aqp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11830 (Aqp5)
Transporters [BR:mmu02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    11830 (Aqp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 11830
NCBI-ProteinID: NP_033831
MGI: 106215
Ensembl: ENSMUSG00000044217
UniProt: Q9WTY4
Position
15 F1; 15 56.13 cM
AA seq 265 aa AA seqDB search
MKKEVCSVAFFKAVFAEFLATLIFVFFGLGSALKWPSALPTILQISIAFGLAIGTLAQAL
GPVSGGHINPAITLALLIGNQISLLRAIFYVAAQLVGAIAGAGILYWLAPGNARGNLAVN
ALSNNTTPGKAVVVELILTFQLALCIFSSTDSRRTSPVGSPALSIGLSVTLGHLVGIYFT
GCSMNPARSFGPAVVMNRFSPSHWVFWVGPIVGAVLAAILYFYLLFPSSLSLHDRVAVVK
GTYEPEEDWEDHREERKKTIELTAH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaggtgtgttcagttgccttcttcaaggccgtgttcgcagagttcctggcc
accctcatcttcgtcttctttggcctgggctcggcactcaagtggccctcggcgctgccc
accattctgcagatctccatagcctttggcctggccataggtaccttggcccaagccctg
ggacctgtgagtggtggccacatcaatccggccattactctggccctcttaataggcaac
cagatctctctgctccgagccatcttctacgtggcagcccagctggtgggtgccattgct
ggagcaggcatcctgtactggttggcgccaggcaatgcccggggtaacctggccgtcaat
gcgctcagcaacaacacaacaccaggcaaggccgtggtggtggagttaatcttgactttc
cagctggccctctgcatcttctcctccacggactcccgccgcaccagcccggtgggctcc
ccagccttatccattggcttgtcggtcacactgggccatcttgtggggatctacttcacc
ggctgttccatgaacccagcccgatctttcggccctgcggtggtcatgaatcggttcagc
ccctctcactgggtcttctgggtaggaccgatcgtgggggccgtcctggctgcaatcctc
tacttctacttgcttttcccctcctcgctgagcctccacgaccgtgtggctgtggtcaaa
ggcacatatgagccagaggaggactgggaagatcatagagaggagcggaagaagaccatc
gagctgacggcacactga

DBGET integrated database retrieval system