KEGG   Mus musculus (house mouse): 11833
Entry
11833             CDS       T01002                                 
Symbol
Aqp8, AI255744, AQP-8
Name
(RefSeq) aquaporin 8
  KO
K09869  aquaporin-8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    11833 (Aqp8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11833 (Aqp8)
Transporters [BR:mmu02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    11833 (Aqp8)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 11833
NCBI-ProteinID: NP_031500
MGI: 1195271
Ensembl: ENSMUSG00000030762
UniProt: P56404 Q3UJ16
Position
7:123061517..123067226
AA seq 261 aa
MSGEQTPMCSMDLPEVKVKTSMAGRCRVFWYEQYVQPCIVELVGSALFIFIGCLSVIENS
PNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFG
GLIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGIEIILTMLLVLAVCMGAVNEK
TMGPLAPFSIGFSVIVDILAGGSISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLF
VGLLIRLLIGDEKTRLILKSR
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtctggggagcagacaccaatgtgtagtatggacctacctgaggtcaaggtgaagacc
agcatggctggcagatgccgtgtgttctggtatgagcaatacgtacaaccatgtatagtg
gaacttgtgggctccgctctcttcatcttcatcggatgtctatcggtcattgagaatagt
ccgaatactgggctcctgcagcctgccttggctcatgggctggccttggggctcatcatt
gctaccttggggaacatcagcggtggacacttcaaccctgctgtgtcgctggcagtcaca
gtgatcggaggcctcaagaccatgctgctaattccctattggatctcccagctatttgga
gggctgattggggctgccttggctaaagtggtgagtccagaggaaagattctggaatgca
tctggggcagcctttgccatcgtccaggagcaggagcaggtggcagaagccctggggata
gagatcattctgacaatgctgttggtattggctgtgtgtatgggtgctgtcaatgagaag
acaatgggccctttagccccattctccattggcttctctgtcattgtggacatcctggca
ggtggtagcatctctggagcctgcatgaaccctgctcgtgcctttggacctgctgtgatg
gctggctactgggacttccattggatctactggctgggccccctcctggctggcctcttt
gtaggactgctcattaggctcctcatcggagatgagaaaacccgcctaattctaaagtcg
aggtga

DBGET integrated database retrieval system