KEGG   Mus musculus (mouse): 11836Help
Entry
11836             CDS       T01002                                 

Gene name
Araf, 1200013E08Rik, A-Raf, AW495444, Araf1
Definition
(RefSeq) Araf proto-oncogene, serine/threonine kinase
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04068  FoxO signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04650  Natural killer cell mediated cytotoxicity
mmu04720  Long-term potentiation
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05034  Alcoholism
mmu05160  Hepatitis C
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Module
mmu_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    11836 (Araf)
   04012 ErbB signaling pathway
    11836 (Araf)
   04068 FoxO signaling pathway
    11836 (Araf)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    11836 (Araf)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    11836 (Araf)
  Endocrine system
   04910 Insulin signaling pathway
    11836 (Araf)
   04914 Progesterone-mediated oocyte maturation
    11836 (Araf)
   04928 Parathyroid hormone synthesis, secretion and action
    11836 (Araf)
  Circulatory system
   04270 Vascular smooth muscle contraction
    11836 (Araf)
  Nervous system
   04726 Serotonergic synapse
    11836 (Araf)
   04720 Long-term potentiation
    11836 (Araf)
   04730 Long-term depression
    11836 (Araf)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    11836 (Araf)
   05205 Proteoglycans in cancer
    11836 (Araf)
   05210 Colorectal cancer
    11836 (Araf)
   05212 Pancreatic cancer
    11836 (Araf)
   05225 Hepatocellular carcinoma
    11836 (Araf)
   05226 Gastric cancer
    11836 (Araf)
   05214 Glioma
    11836 (Araf)
   05221 Acute myeloid leukemia
    11836 (Araf)
   05220 Chronic myeloid leukemia
    11836 (Araf)
   05218 Melanoma
    11836 (Araf)
   05211 Renal cell carcinoma
    11836 (Araf)
   05219 Bladder cancer
    11836 (Araf)
   05215 Prostate cancer
    11836 (Araf)
   05213 Endometrial cancer
    11836 (Araf)
   05224 Breast cancer
    11836 (Araf)
   05223 Non-small cell lung cancer
    11836 (Araf)
  Substance dependence
   05034 Alcoholism
    11836 (Araf)
  Infectious diseases
   05160 Hepatitis C
    11836 (Araf)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    11836 (Araf)
   01522 Endocrine resistance
    11836 (Araf)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11836 (Araf)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   11836 (Araf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like APH TUG-UBL1 Kdo
Motif
Other DBs
NCBI-GeneID: 11836
NCBI-ProteinID: NP_033833
MGI: 88065
Ensembl: ENSMUSG00000001127
Vega: OTTMUSG00000017167
UniProt: P04627
Position
X A1.3; X 16.3 cM
AA seq 604 aa AA seqDB search
MEPPRGPPVSGAEPSRAVGTVKVYLPNKQRTVVTVREGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGGSRQQEAPSNLSVNELL
TPQGPSPFTQQRDQEHFSFPAPANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTAQSFS
TDAAGRGGDGAPRGSPSPASVSSGRKSPHSKLPSEQRERKSLADEKKKVKNLGYRDSGYY
WEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTR
HVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHA
KNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQD
PNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSNCPKAM
RRLLTDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAA
RLVP
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaccacgaggccctcctgttagtggggctgagccatctcgggcagttggcact
gtcaaagtgtacctgcctaacaagcaacgcacagtggtgactgtccgggaaggcatgagt
gtctatgactctttggacaaggccctgaaggtgcggggtctcaaccaggactgctgtgtg
gtctacaggctcatcaaaggaagaaagacagtcactgcctgggacacagccattgcgcct
ctggatggtgaggagctcattgtggaggtcctagaagatgtgccactgaccatgcacaat
tttgtacggaagacattcttcagcctggccttctgtgacttctgccttaagtttctgttc
catggattccgctgccagacctgtggctacaagttccaccagcattgttcctccaaggtc
cccaccgtctgcgttgacatgagtaccaaccgccgacagttctaccacagcatccaggat
ctgtctggaggctccaggcagcaggaggctccctcaaatctctctgtgaatgagctgcta
accccccagggtcccagcccctttacccagcaacgtgaccaggagcacttctcattccct
gcccctgccaatcccccactgcagcgcatccgctccacatctactcctaacgtccacatg
gtcagcaccacagctcccatggactccagcctcatgcagtttactgctcagagcttcagc
accgatgctgctggtagaggtggtgatggagcccctcggggtagccctagcccagctagt
gtgtcttcagggaggaagtccccacattccaagttaccttcagaacagcgggagcggaag
tccttggcagatgaaaagaaaaaagtgaagaacctggggtaccgggactcaggctattac
tgggaggtgccacccagtgaggtacagctgttgaagaggatcgggacaggctcttttggc
actgtgtttcgggggcgttggcatggcgatgtagctgtgaaagtgctcaaggtggcccaa
cctaccgctgagcaggcccaggccttcaagaatgagatgcaggtgctcaggaagacacgg
catgtcaacattttgctgttcatgggtttcatgactcggccggggtttgccatcatcaca
cagtggtgtgagggttccagcctctaccaccacctacatgtggctgacacgcgctttgac
atggtccagctcattgatgtggcccggcagactgcccagggcatggactacctccacgcc
aagaacatcattcatcgagacctaaagtccaacaatatcttcttacatgaggggctcaca
gtcaagattggtgacttcggcctggccacagtgaagacacggtggagtggggcacagccc
ttagagcagccctcagggtctgtgctatggatggcagctgaggtgatccgtatgcaggac
ccgaacccctacagcttccagtcggatgtctatgcctatggtgttgtgctctatgagctc
atgaccggctcactgccctacagccacattggcagccgtgaccagatcatctttatggtg
ggccgtggctatctgtctccggacctcagcaaaatcttcagtaattgccccaaagccatg
aggcgcctgctgactgactgcctcaagttccagcgggaggagcggcccctatttccccag
attctggccacgatcgagctactgcagcggtcactccccaagattgagcggagtgcctcc
gaaccctccttgcaccgcacccaggctgatgagttgcctgcttgccttctcagcgcagcc
cgtcttgtgccttag

DBGET integrated database retrieval system