KEGG   Mus musculus (mouse): 118445Help
Entry
118445            CDS       T01002                                 

Gene name
Klf16, AI843742, BTEB4, DRRF
Definition
(RefSeq) Kruppel-like factor 16
  KO
K09208  krueppel-like factor 9/13/14/16
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    118445 (Klf16)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    118445 (Klf16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC zf-C2H2_6 zf-C2H2_8 zf-Di19
Motif
Other DBs
NCBI-GeneID: 118445
NCBI-ProteinID: NP_510962
MGI: 2153049
Ensembl: ENSMUSG00000035397
Vega: OTTMUSG00000040152
UniProt: P58334 B2RPU7
Position
10; 10 C1
AA seq 251 aa AA seqDB search
MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRATRREATPPGTPGAPP
PPATAPGPGGATAAPHLLAASILADLRGGPVVATAASTAGGTSPVSSSSAASSPSSGRAP
GAAKSHRCPFHGCAKAYYKSSHLKSHLRTHTGERPFACDWPGCDKKFARSDELARHHRTH
TGEKRFPCPLCTKRFTRSDHLTKHARRHPGFRPELLRRPGARSVSPSDSLPCSLAGSPTP
SPVPSPAPAGL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggccgtggcgtgtgtggattactttgccgccgacgtgctcatggccatctcc
tcgggagccgtggtgcatcgcggacgacccggccccgagggcgcgggccccgctgccggt
ctggatgtgcgcgccacgcgccgcgaggccacgccgccggggacccctggggcaccgcca
ccgccagctacggctccggggccgggaggcgccaccgctgcgccccacctgctggccgcc
agcatcctggccgatctgagaggcgggccggtagtcgccaccgcagccagcaccgcgggg
ggcacctctccggtctcctcctcctcagccgcttcgtctccctcttcgggccgcgccccc
ggcgccgccaaaagccaccgctgtcccttccatggctgcgccaaagcctattacaagtct
tcgcacctcaagtcacacctgcggactcacacaggtgagcggccctttgcctgcgactgg
cctggctgtgacaagaagttcgcccgttctgatgagctggcccgccaccaccggacgcac
accggggagaagcgcttcccctgccccctgtgtaccaagcggttcacccgaagcgaccac
ctgaccaagcacgcccggcgacatcccggcttccgcccggaactcctgcgacgacctggt
gcccgcagcgtctcgcccagcgactcgctgccctgcagcttggctggaagccccacacct
agccctgtccccagcccagctcctgctggcttgtag

DBGET integrated database retrieval system