KEGG   Mus musculus (mouse): 11845
Entry
11845             CDS       T01002                                 

Gene name
Arf6, AI788669, AW496366
Definition
(RefSeq) ADP-ribosylation factor 6
  KO
K07941  ADP-ribosylation factor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04666  Fc gamma R-mediated phagocytosis
mmu05132  Salmonella infection
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11845 (Arf6)
   04072 Phospholipase D signaling pathway
    11845 (Arf6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11845 (Arf6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    11845 (Arf6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    11845 (Arf6)
   05135 Yersinia infection
    11845 (Arf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11845 (Arf6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11845 (Arf6)
   04031 GTP-binding proteins [BR:mmu04031]
    11845 (Arf6)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    11845 (Arf6)
  Arf GTPases and associated proteins
   Arf GTPases
    11845 (Arf6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11845 (Arf6)
  Exosomal proteins of colorectal cancer cells
   11845 (Arf6)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    11845 (Arf6)
SSDB
Motif
Pfam: Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 6PF2K SpoOE-like
Other DBs
NCBI-GeneID: 11845
NCBI-ProteinID: NP_031507
MGI: 99435
Ensembl: ENSMUSG00000044147
UniProt: P62331 Q3U0D7
Structure
PDB: 
3VHX

Position
12; 12 C2
AA seq 175 aa
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
NT seq 528 nt   +upstreamnt  +downstreamnt
atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgctgggc
ctggacgcagccggcaagacaacgatcctgtacaagttgaagctgggccaatcggtgacc
accatccccacggtgggcttcaacgtggagacggtgacttacaaaaacgtcaagttcaac
gtgtgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg
acccagggtctgatcttcgtggtagactgcgccgaccgcgaccgcatcgacgaggcccgc
caggagctgcaccgcattatcaatgaccgggagatgagggacgccatcatcctcatcttc
gccaacaagcaggacctgcccgatgccatgaaaccccatgagatccaggagaaactgggc
ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctccggggac
ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system