KEGG   Mus musculus (house mouse): 118453
Entry
118453            CDS       T01002                                 
Symbol
Mmp28, D130023P12
Name
(RefSeq) matrix metallopeptidase 28 (epilysin)
  KO
K08006  matrix metalloproteinase-28 (epilysin) [EC:3.4.24.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    118453 (Mmp28)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M10
   118453 (Mmp28)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_4 DUF4953 Reprolysin_5 Reprolysin_3 Metallopep Peptidase_M66 Reprolysin_2 Peptidase_M54
Other DBs
NCBI-GeneID: 118453
NCBI-ProteinID: NP_001307229
MGI: 2153062
Ensembl: ENSMUSG00000020682
UniProt: Q8BG29 Q8CGV8
Position
11:complement(83331594..83353890)
AA seq 520 aa
MVAGVSLLLRALPLLLWGCQDAQPTQHGLPELRQEAEAFLEKYGYLSEQGSKAPASAQFR
NAIREFQWISQLPLSGVLDQATLRQMTRPRCGVADTDSHATWTERISTLLAGHRAKMRRK
KRFAKPGNKWYKQHLSYRLVNWPERLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPAD
IRLTFFQGDHNDGLANAFDGPGGALAHAFLPRRGEAHFDGDERWSLSRRRGRNLFVVLAH
EIGHTLGLTHSPAPRALMAPYYKKLGRDALLSWDDVLAVQSLYGKPLGRSVATQLPGKVF
TDFEAWDPHNSQSRRPETRGPKYCHSSFDAITVDGQWRLYVFKGSYFWEVTVDGNVSEPR
PLQKRWPGLPPGIEAAAVSLEDGDFYFFKGNRCWRFQGTKSVWGFAQLCRAGGLPRHPDA
ALFFPPLRRLVLFKGSRYYVLAQGGMQVEPYYPRSLRDWAGVPEEVSGALPRPDGSIIFF
RDDHYWHLDQAKLRVTSSGRWATELSWMGCWNANSGGALF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggtggctggcgtgagtctcctgctgcgcgccctgccgctgctgctgtggggctgccag
gacgcacagcccacccagcacggactcccggagctgcgccaggaggcagaggcattcctg
gagaagtatggatacctcagtgagcagggctccaaagccccagcctccgcacagttcagg
aacgccatcagagagttccagtggatatcccagctgcccctcagtggtgtgctggaccag
gccacactgcgccagatgacccgcccacgctgtggggttgcggatactgacagtcatgcc
acttggacagagaggatcagtaccctgcttgctggacaccgagccaaaatgaggcgtaag
aaacgctttgcaaagccaggtaacaaatggtacaagcagcatctttcctaccgcctggtg
aactggcctgagcgcctgcccgagccagctgttcgaggggccgtgcgcgctgccttccag
ctgtggagtaatgtgtcagcactggagttctgggaagccccagccacgggccctgccgac
atccgcctcaccttcttccaaggagaccacaatgatgggctggccaacgccttcgatggc
ccagggggtgccctggcacacgcctttctgccccggcggggcgaagcgcatttcgacgga
gacgagcgctggtctctgagccgccgccgtgggcgcaacttgttcgtggtgctggcgcac
gaaatcggccacacgctcggtctcacgcactcgcccgcgccacgggcgcttatggcgccc
tactacaagaagctgggccgcgacgccttgctcagctgggacgatgtgctggcggtgcag
agcctgtacggaaagcctctgggacgctcagtagccacccaactccccggaaaggtgttc
actgactttgaggcctgggacccccacaactcccagagcagacgcccggaaaccagaggt
cctaaatactgccactcttcctttgatgccatcactgtagatgggcaatggcgactgtat
gtcttcaaagggagttacttctgggaagtcacagttgatggcaatgtttcagagcctcgt
ccactacagaaaagatggccaggactgccacctggtattgaggctgctgcagtgtctttg
gaagatggagacttctacttctttaaagggaatcgttgttggaggttccagggcacgaag
tccgtgtgggggttcgcacagctctgccgggcaggtggtctaccccgacacccggacgca
gctctcttcttcccgcctctgcgccgcctagtcctcttcaagggttcccgctactacgtg
ctagctcaaggagggatgcaagtggagccctactatccccgcagcctgcgagactgggcc
ggtgtccccgaggaggtcagcggcgccctgccaaggccggatggctccattatcttcttc
agagatgaccactattggcatttggatcaagccaaactgcgggtgaccagctccggtcgc
tgggctaccgagctgtcctggatgggctgttggaatgccaactcaggaggtgccctgttc
tga

DBGET integrated database retrieval system