KEGG   Mus musculus (mouse): 11847Help
Entry
11847             CDS       T01002                                 

Gene name
Arg2, AII, AU022422
Definition
(RefSeq) arginase type II
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
mmu05146  Amoebiasis
Module
mmu_M00029  Urea cycle
mmu_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    11847 (Arg2)
   00330 Arginine and proline metabolism
    11847 (Arg2)
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    11847 (Arg2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     11847 (Arg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 11847
NCBI-ProteinID: NP_033835
MGI: 1330806
Ensembl: ENSMUSG00000021125
Vega: OTTMUSG00000033846
UniProt: O08691
Position
12; 12 C3
AA seq 354 aa AA seqDB search
MFLRSSASRLLHGQIPCVLTRSVHSVAIVGAPFSRGQKKLGVEYGPAAIREAGLLKRLSR
LGCHLKDFGDLSFTNVPQDDPYNNLVVYPRSVGLANQELAEVVSRAVSGGYSCVTMGGDH
SLAIGTIIGHARHRPDLCVIWVDAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPG
FSWIKPCLSPPNIVYIGLRDVEPPEHFILKNYDIQYFSMREIDRLGIQKVMEQTFDRLIG
KRQRPIHLSFDIDAFDPKLAPATGTPVVGGLTYREGVYITEEIHNTGLLSALDLVEVNPH
LATSEEEAKATARLAVDVIASSFGQTREGGHIVYDHLPTPSSPHESENEECVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaggagcagcgcctcccgtctcctccacgggcaaattccttgcgtcctgacg
agatccgtccactctgtagctatagtcggagcccctttctctcggggacagaagaagcta
ggagtggaatatggtccagctgccattcgagaagctggcttgctgaagaggctctccagg
ttgggatgccacctaaaagactttggagacttgagttttactaatgtcccacaagatgat
ccctacaataatctggttgtgtatcctcgttcagtgggccttgccaaccaggaactggct
gaagtggttagtagagctgtgtcaggtggctacagctgtgtcaccatgggaggagaccac
agcctggcaataggtaccattatcggtcacgcccggcaccgcccagatctctgtgtcatc
tgggttgatgctcatgcggacattaatacacctctcaccactgtatctggaaatatacat
ggacagccactttcctttctcatcaaagaactacaagacaaggtaccacaactgccagga
ttttcctggatcaaaccttgcctctctcccccaaatattgtgtacattggcctgagagat
gtggagcctcctgaacattttattttaaagaattatgacatccagtatttttccatgaga
gagattgatcgacttgggatccagaaggtgatggaacagacatttgatcggctgattggc
aaaaggcagaggccaatccacctgagttttgacattgatgcatttgaccctaaactggct
ccagccacaggaacccctgttgtagggggattaacctacagagaaggagtgtatattact
gaagaaatacataatacagggttgctgtcagctctggatcttgttgaagtcaatcctcat
ttggccacttctgaggaagaggccaaggcaacagccagactagcagtggatgtgattgct
tcaagttttggtcagacaagagaaggaggacacattgtctatgaccaccttcctactcct
agttcaccacacgaatcagaaaatgaagaatgtgtgagaatttag

DBGET integrated database retrieval system