KEGG   Mus musculus (mouse): 11852Help
Entry
11852             CDS       T01002                                 

Gene name
Rhob, AA017882, Arh6, Arhb
Definition
(RefSeq) ras homolog family member B
  KO
K07856  Ras homolog gene family, member B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    11852 (Rhob)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    11852 (Rhob)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase Gtr1_RagA SRPRB
Motif
Other DBs
NCBI-GeneID: 11852
NCBI-ProteinID: NP_031509
MGI: 107949
Ensembl: ENSMUSG00000054364
UniProt: P62746 Q4FJM5
Position
12; 12 A1.1
AA seq 196 aa AA seqDB search
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKD
LRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ
KRYGSQNGCINCCKVL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatccgcaagaagctggtggtggtgggcgacggcgcgtgcggcaagacgtgc
ctgctgatcgtgttcagtaaagacgaattccccgaggtgtacgtgcccaccgtgttcgag
aactatgtggcggacatcgaggtggacggcaagcaggtggagctggcgctgtgggacacg
gcaggccaggaggactacgatcgtttacggccgctctcctatccggacaccgacgtcatc
cttatgtgcttctcggtggacagcccggactctctcgagaacatccccgagaagtgggtg
cccgaggtaaagcacttctgccccaatgtgcccatcatcctggtggccaacaaaaaagac
ctgcgcagcgacgagcatgtccgcacggagctggcccgcatgaagcaggagccagtgcgc
acggatgacggccgcgccatggcggtgcgcatccaagcctatgactacctcgagtgctcg
gccaagaccaaggagggcgtgcgcgaggtttttgagacggccacgcgcgccgcgctgcag
aagcgctacggatcccagaatggctgcatcaactgctgcaaggtgctatga

DBGET integrated database retrieval system