KEGG   Mus musculus (mouse): 11855Help
Entry
11855             CDS       T01002                                 

Gene name
Arhgap5, p190-B, p190B
Definition
(RefSeq) Rho GTPase activating protein 5
  KO
K13709  Rho GTPase-activating protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11855 (Arhgap5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    11855 (Arhgap5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11855 (Arhgap5)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    11855 (Arhgap5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP RhoGAP-FF1 Ras FF GTP_EFTU NOG1 Roc MMR_HSR1 U5_2-snRNA_bdg
Motif
Other DBs
NCBI-GeneID: 11855
NCBI-ProteinID: NP_033836
MGI: 1332637
Ensembl: ENSMUSG00000035133
UniProt: E9PYT0
Position
12 C1; 12 22.16 cM
AA seq 1503 aa AA seqDB search
MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYISTLPRAFNTLLPDLEEIEHLN
WLEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRIEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQYCTDIKVENLLATSLLEMDHNRVRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYILSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMTNLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPTGTYPRKFNESQIKQALRGVLESVKHNLDVVSPVPINKDVSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
VHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDMDSSDNYVEPLDTIFKQKGYSDEIYVVPDDSQNRIIKIRNSFVNNTQGDEENGFSD
RTSKGHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDP
LLSPVETWKGGIDNPAITSDQEVDDKKIKKKTHKVKEDKKQKKKTKTFNPPTRRNWESNY
FGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNIN
LASMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERFHALKEIVKKFHP
VNYDVFRYVITHLNRVSQQNKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVE
TFIQQCQFFFYNGEIVETANTVAPPPTSNPGQLVESMVPLQLPPPLQPQLIQPQLQTDPL
GII
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgacccccatcttatactgtcagtgtagttggactc
tctgggactgaaaaagacaaaggaaactgtggagttggaaaatcttgtttgtgcaataga
tttgtacgttcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccatt
gactttggaggccgagtagtaaacaatgatcactttttatactggggtgacataacacaa
aatggtgaagatggtgtagaatgcaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcgaagtacaaatttgcaaccatatataaaacgtgcagct
gcctcaaaattgcagtcagcagaaaaactaatgtacatttgtaccgatcagctaggcttg
gagcaagactttgaacagaagcaaatgcctgaagggaaactcaatgtagatggattttta
ttgtgtattgatgtgagtcaaggatgtaataggaagtttgatgatcaacttaaatttgtg
aataacctttttgtccagctatcaaaatccaaaaagcctgtgataatagcagcaactaaa
tgtgatgaatgtgtggatcattaccttagagaagttcaagcctttgcctcaaacaaaaag
aatcttctagtagtggaaacatcagcacgatttaatgtcaacattgagacatgtttcact
gctttggtacaaatgttggataaaactcgtggcaaacctaaaattattccctatctggat
gcttataaaacacagagacaacttgttgtcacagcaacagacaagtttgaaaaacttgta
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatatatcaacttagagggaacaagaaaggccagaaatacattctca
aagcatatagagcaactcaaacaggaacatataagaaaaaggagagaagaatatataagt
accttaccaagggcttttaatactctcttgccagatctagaagagattgaacatttgaat
tggttggaagctttgaagttaatggaaaagagagcagatttccagttatgttttgtggtg
ctagaaaaaacaccttgggatgaaactgaccatatagacaaaattaatgatagacggatc
ccattcgaccttctgagcactttagaagcagaaaaagtctatcaaaaccatgtacaacat
ctgatatcagagaaaagaagaatagaaatgaaggagaaattcaagaagactttagaaaaa
attcagttcatttcacctgggcagccatgggaggaagttatgtgttttgtcatggaggat
gaagcattcaaatacatcactgaggctgatagcaaagaagtatatggtaggcatcagcga
gagatagtagaaaaagccaaagaagagtttcaggaaatgctttttgagcattctgaactt
ttttatgatttagatcttaatgcaacaccaagttctgataaaatgagtgaaattcatacc
gttctaagtgaagaacctagatataaagctttacagaaacttgcacctgatagagaatct
cttctacttaagcatataggatttgtttatcatcccactaaagaaacatgcctcagtggc
caatattgtacagacattaaagtggaaaatttacttgccactagtctattagagatggat
cataaccgcgtacgcttgtatcatgatagtaccaatatagacaaagttaatcttttcatt
ttagggaaagatggccttgcccaggaactagcaaatgagataaggactcaatccactgat
gatgagtatgccttagatggaaaaatttatgaacttgatcttcggcctgttgatgccaaa
tcgccttacattttgagtcagctatggactgcagcctttaaaccacatgggtgcttctgt
gtattcaattccatcgagtcactgagttttattggagaatttattggaaaaataagaacc
gaagcatctcagatcagaaaagataaatatatgactaatcttccatttacattaattctt
gctaatcagagggattccattagtaaaaatctaccaattctcaggcaccagggtcagcag
ttggccaacaaattgcagtgtccttttgtagacgtacctactggtacatatcctcgtaaa
tttaatgaatcacaaataaagcaagctctaagaggagtattggaatcagttaaacacaat
ttagatgtggtgagcccagttcctatcaataaggatgtgtcagaagctgacttgagaatt
gtcatgtgtgccatgtgtggcgatccatttagtgtggatctcattctttcacctttcctt
gactctcattcttgcagtgctgctcaagctggacagaataattctttaatgcttgacaaa
attattggtgaaaaaaggaggcgaatacagatcacaatattgtcataccactcctcaatt
ggagtaagaaaagatgaactggttcatgggtatatattagtttattctgcaaaaaggaaa
gcatcaatgggaatgcttcgtgcatttctatcagaagttcaagatactattcctgtacaa
ctggtggcagttactgacagtcaagctgatttctttgaaaatgaggctatcaaggagtta
atgactgaaggagaacacattgcaactgagataaccgctaaatttacagcattatattct
ttatctcagtatcataggcaaactgaggttttcactttgtttttcagtgatgttctagag
aaaaaaaatatgatagaaaattcctatttgtctgataatacaagggaatccactcatcag
agtgaagatgtttttctaccgtctccaagagactgttttccctataacaactaccctgat
tcagatgatgacacagaagcaccacctccatatagtccaattggagatgatgtacagttg
cttccaacacctagtgaccgttccagatacaggttagatttggaaggaaatgagtatcct
gttcatagcactccaaattgtcacgatcatgaacgtaaccataaagtgcctccacctatt
aaacctaaaccagttgtacctaaaacaaatgtgaaaaaactggatccaaaccttttaaaa
acaattgaagctggtattggtaaaaatccaagaaaacagacttcccgggtgcctttggca
catcctgaagatatggattcttcagataactatgtggaaccccttgacacaattttcaag
cagaagggctattctgatgagatttatgttgtcccagatgatagtcagaatcgaattatt
aaaattcgaaactcatttgtaaataacactcaaggagatgaagaaaatgggttttctgat
agaacctcaaaaggtcatggagagcgtaggccttcaaaatataaatataaatctaaaact
ttgtttagtaaagccaagtcatactacagaagaacacactcagatgcaagcgatgatgag
gctttcactacttccaaaacaaaaagaaaaggaagacatcgtggaagtgaagaagatcca
ctactgtctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacatctgac
caggaggtagatgataagaagataaagaagaaaacccacaaagtaaaggaagataaaaag
cagaaaaagaaaactaagaccttcaacccaccaacacgtagaaattgggaaagtaattac
tttgggatgcccctccaggatctggttacagctgagaagcctataccactatttgttgaa
aaatgtgtggaatttattgaagacacaggattatgtactgaaggactataccgtgttagt
ggaaataaaactgatcaagacaacattcaaaagcagtttgatcaagatcataatatcaat
ctagcatcaatggaagtgacagtcaatgctgtagctggagctctcaaagctttctttgct
gacctgccggatcctttgattccatattcactccacccagagctattggaagcagcaaaa
atcccagataaaacagagcgctttcatgccttgaaagaaattgttaagaaatttcatcct
gtaaactatgatgtattcagatatgtgataacacatctaaacagggttagtcagcaaaat
aaaatcaacctaatgacagcagacaacttatccatctgtttttggccaactttgatgaga
cctgattttgaaaatcgagagtttctgtctaccactaaaatccatcaatctgtcgttgaa
acatttattcaacagtgccagtttttcttttacaatggagaaattgtagaaactgcgaac
actgtggctcctccacctacttcaaatccaggacaattggtagaatcaatggtaccactt
cagttgccaccaccattgcaacctcagctaattcaaccacaattgcagacagatcctctt
ggtattatataa

DBGET integrated database retrieval system