KEGG   Mus musculus (mouse): 11855
Entry
11855             CDS       T01002                                 

Gene name
Arhgap5, p190, p190-, p190-B, p190B
Definition
(RefSeq) Rho GTPase activating protein 5
  KO
K13709  Rho GTPase-activating protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    11855 (Arhgap5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    11855 (Arhgap5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11855 (Arhgap5)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    11855 (Arhgap5)
SSDB
Motif
Pfam: RhoGAP RhoGAP-FF1 Ras FF GTP_EFTU NOG1 Roc MMR_HSR1 U5_2-snRNA_bdg
Other DBs
NCBI-GeneID: 11855
NCBI-ProteinID: NP_033836
MGI: 1332637
Ensembl: ENSMUSG00000035133
UniProt: E9PYT0
Position
12 C1; 12 22.16 cM
AA seq 1503 aa
MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYISTLPRAFNTLLPDLEEIEHLN
WLEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRIEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQYCTDIKVENLLATSLLEMDHNRVRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYILSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMTNLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPTGTYPRKFNESQIKQALRGVLESVKHNLDVVSPVPINKDVSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
VHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDMDSSDNYVEPLDTIFKQKGYSDEIYVVPDDSQNRIIKIRNSFVNNTQGDEENGFSD
RTSKGHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDP
LLSPVETWKGGIDNPAITSDQEVDDKKIKKKTHKVKEDKKQKKKTKTFNPPTRRNWESNY
FGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNIN
LASMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERFHALKEIVKKFHP
VNYDVFRYVITHLNRVSQQNKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVE
TFIQQCQFFFYNGEIVETANTVAPPPTSNPGQLVESMVPLQLPPPLQPQLIQPQLQTDPL
GII
NT seq 4512 nt   +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgacccccatcttatactgtcagtgtagttggactc
tctgggactgaaaaagacaaaggaaactgtggagttggaaaatcttgtttgtgcaataga
tttgtacgttcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccatt
gactttggaggccgagtagtaaacaatgatcactttttatactggggtgacataacacaa
aatggtgaagatggtgtagaatgcaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcgaagtacaaatttgcaaccatatataaaacgtgcagct
gcctcaaaattgcagtcagcagaaaaactaatgtacatttgtaccgatcagctaggcttg
gagcaagactttgaacagaagcaaatgcctgaagggaaactcaatgtagatggattttta
ttgtgtattgatgtgagtcaaggatgtaataggaagtttgatgatcaacttaaatttgtg
aataacctttttgtccagctatcaaaatccaaaaagcctgtgataatagcagcaactaaa
tgtgatgaatgtgtggatcattaccttagagaagttcaagcctttgcctcaaacaaaaag
aatcttctagtagtggaaacatcagcacgatttaatgtcaacattgagacatgtttcact
gctttggtacaaatgttggataaaactcgtggcaaacctaaaattattccctatctggat
gcttataaaacacagagacaacttgttgtcacagcaacagacaagtttgaaaaacttgta
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatatatcaacttagagggaacaagaaaggccagaaatacattctca
aagcatatagagcaactcaaacaggaacatataagaaaaaggagagaagaatatataagt
accttaccaagggcttttaatactctcttgccagatctagaagagattgaacatttgaat
tggttggaagctttgaagttaatggaaaagagagcagatttccagttatgttttgtggtg
ctagaaaaaacaccttgggatgaaactgaccatatagacaaaattaatgatagacggatc
ccattcgaccttctgagcactttagaagcagaaaaagtctatcaaaaccatgtacaacat
ctgatatcagagaaaagaagaatagaaatgaaggagaaattcaagaagactttagaaaaa
attcagttcatttcacctgggcagccatgggaggaagttatgtgttttgtcatggaggat
gaagcattcaaatacatcactgaggctgatagcaaagaagtatatggtaggcatcagcga
gagatagtagaaaaagccaaagaagagtttcaggaaatgctttttgagcattctgaactt
ttttatgatttagatcttaatgcaacaccaagttctgataaaatgagtgaaattcatacc
gttctaagtgaagaacctagatataaagctttacagaaacttgcacctgatagagaatct
cttctacttaagcatataggatttgtttatcatcccactaaagaaacatgcctcagtggc
caatattgtacagacattaaagtggaaaatttacttgccactagtctattagagatggat
cataaccgcgtacgcttgtatcatgatagtaccaatatagacaaagttaatcttttcatt
ttagggaaagatggccttgcccaggaactagcaaatgagataaggactcaatccactgat
gatgagtatgccttagatggaaaaatttatgaacttgatcttcggcctgttgatgccaaa
tcgccttacattttgagtcagctatggactgcagcctttaaaccacatgggtgcttctgt
gtattcaattccatcgagtcactgagttttattggagaatttattggaaaaataagaacc
gaagcatctcagatcagaaaagataaatatatgactaatcttccatttacattaattctt
gctaatcagagggattccattagtaaaaatctaccaattctcaggcaccagggtcagcag
ttggccaacaaattgcagtgtccttttgtagacgtacctactggtacatatcctcgtaaa
tttaatgaatcacaaataaagcaagctctaagaggagtattggaatcagttaaacacaat
ttagatgtggtgagcccagttcctatcaataaggatgtgtcagaagctgacttgagaatt
gtcatgtgtgccatgtgtggcgatccatttagtgtggatctcattctttcacctttcctt
gactctcattcttgcagtgctgctcaagctggacagaataattctttaatgcttgacaaa
attattggtgaaaaaaggaggcgaatacagatcacaatattgtcataccactcctcaatt
ggagtaagaaaagatgaactggttcatgggtatatattagtttattctgcaaaaaggaaa
gcatcaatgggaatgcttcgtgcatttctatcagaagttcaagatactattcctgtacaa
ctggtggcagttactgacagtcaagctgatttctttgaaaatgaggctatcaaggagtta
atgactgaaggagaacacattgcaactgagataaccgctaaatttacagcattatattct
ttatctcagtatcataggcaaactgaggttttcactttgtttttcagtgatgttctagag
aaaaaaaatatgatagaaaattcctatttgtctgataatacaagggaatccactcatcag
agtgaagatgtttttctaccgtctccaagagactgttttccctataacaactaccctgat
tcagatgatgacacagaagcaccacctccatatagtccaattggagatgatgtacagttg
cttccaacacctagtgaccgttccagatacaggttagatttggaaggaaatgagtatcct
gttcatagcactccaaattgtcacgatcatgaacgtaaccataaagtgcctccacctatt
aaacctaaaccagttgtacctaaaacaaatgtgaaaaaactggatccaaaccttttaaaa
acaattgaagctggtattggtaaaaatccaagaaaacagacttcccgggtgcctttggca
catcctgaagatatggattcttcagataactatgtggaaccccttgacacaattttcaag
cagaagggctattctgatgagatttatgttgtcccagatgatagtcagaatcgaattatt
aaaattcgaaactcatttgtaaataacactcaaggagatgaagaaaatgggttttctgat
agaacctcaaaaggtcatggagagcgtaggccttcaaaatataaatataaatctaaaact
ttgtttagtaaagccaagtcatactacagaagaacacactcagatgcaagcgatgatgag
gctttcactacttccaaaacaaaaagaaaaggaagacatcgtggaagtgaagaagatcca
ctactgtctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacatctgac
caggaggtagatgataagaagataaagaagaaaacccacaaagtaaaggaagataaaaag
cagaaaaagaaaactaagaccttcaacccaccaacacgtagaaattgggaaagtaattac
tttgggatgcccctccaggatctggttacagctgagaagcctataccactatttgttgaa
aaatgtgtggaatttattgaagacacaggattatgtactgaaggactataccgtgttagt
ggaaataaaactgatcaagacaacattcaaaagcagtttgatcaagatcataatatcaat
ctagcatcaatggaagtgacagtcaatgctgtagctggagctctcaaagctttctttgct
gacctgccggatcctttgattccatattcactccacccagagctattggaagcagcaaaa
atcccagataaaacagagcgctttcatgccttgaaagaaattgttaagaaatttcatcct
gtaaactatgatgtattcagatatgtgataacacatctaaacagggttagtcagcaaaat
aaaatcaacctaatgacagcagacaacttatccatctgtttttggccaactttgatgaga
cctgattttgaaaatcgagagtttctgtctaccactaaaatccatcaatctgtcgttgaa
acatttattcaacagtgccagtttttcttttacaatggagaaattgtagaaactgcgaac
actgtggctcctccacctacttcaaatccaggacaattggtagaatcaatggtaccactt
cagttgccaccaccattgcaacctcagctaattcaaccacaattgcagacagatcctctt
ggtattatataa

KEGG   Mus musculus (mouse): 232906
Entry
232906            CDS       T01002                                 

Gene name
Arhgap35, 6430596G11Rik, AI841135, Grl, Grlf1, mKIAA1722, p19, p190A, p190R, p190RhoGAP
Definition
(RefSeq) Rho GTPase activating protein 35
  KO
K05732  glucocorticoid receptor DNA-binding factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    232906 (Arhgap35)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    232906 (Arhgap35)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    232906 (Arhgap35)
   04670 Leukocyte transendothelial migration
    232906 (Arhgap35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    232906 (Arhgap35)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    232906 (Arhgap35)
SSDB
Motif
Pfam: RhoGAP RhoGAP-FF1 Ras FF Cdh1_DBD_1 NOG1 Thioredoxin_13
Other DBs
NCBI-GeneID: 232906
NCBI-ProteinID: NP_766327
MGI: 1929494
Ensembl: ENSMUSG00000058230
Vega: OTTMUSG00000048052
UniProt: Q91YM2 B2RTN5 Q3UVZ8 Q8CCL8
Position
7; 7 A2
AA seq 1499 aa
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWPSVSRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALIPNLDEVDH
LSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYETHL
EKLRNERKRAEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDRAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLISSRFIRPSDRNQKNSLSDLNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSSTASIKDLADV
DLRIVMCLMCGDPFSADDVLSPVLQSQTCKSSHCGSSNSVLLELPIGLHKKRIELSVLSY
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAIDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLELFHPFFKDVVEKKNIIEATHMYDNVAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDVEPPSYHLFREDATLPSLSKDHSKFSMELEGN
DGLSFIMSNFESKLNNKVPPPVKPKPPVHFDITKDLSYLDQGHREGQRKSMSSSPWMPQD
GFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDT
SSLERGRKVSAVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKG
DNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKP
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGA
MKSFFSELPDPLVPYSMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLN
KVSHNNKVNLMTSENLSICFWPTLMRPDFSSMDALTATRSYQTIIELFIQQCPFFFYNRP
ISEPPGAAPGSPSAMAPTVPFLTSTPATSQPSPPQSPPPTPQSPMQPLLSSQLQAEHTL
NT seq 4500 nt   +upstreamnt  +downstreamnt
atgatgatggcaagaaagcaagatgtccgcatccccacctacaacatcagtgtggtggga
ttgtcaggcactgagaaggagaaaggccagtgcggcattgggaagtcttgtctgtgtaac
cgctttgtgcgcccaagtgctgatgagtttcacctggaccacacttctgtccttagcacc
agtgactttggtgggcgggtggtcaataatgaccactttctgtactggggagaagttagc
cgctccctggaggattgtgtggaatgtaagatgcacattgtggagcagactgagtttatt
gacgatcagacttttcaacctcatcgaagcacggcactgcagccctacatcaagagagcc
gcagccaccaagcttgcttcagctgaaaaactcatgtatttttgcactgaccagctggga
ctggagcaagactttgagcagaaacagatgccagatgggaagctgctggttgacggtttc
cttctgggcattgatgttagcaggggcatgaacaggaacttcgatgatcagctcaaattt
gtctccaatctctacaatcagcttgcaaaaacaaaaaagcccatagtggtagtcctgact
aagtgtgatgagggcgttgagcggtacattagagatgcacatacttttgccttaagcaaa
aagaacctccaggttgtagagacctctgcaaggtccaatgtgaatgtggacttggctttc
agcaccttagtgcaactcattgataagagtcgagggaagacaaaaatcatcccttacttt
gaagctctcaagcagcagagtcagcagatagctacagcaaaggacaagtatgagtggtta
gtgagccgcattgtgaaaaatcacaatgagaactggccgagtgtcagccgaaagatgcag
gcctcccctgagtaccaggactatgtctacctggaagggacacagaaggccaagaagctc
ttcctgcagcacattcaccgcctcaagcatgagcatattgagcgtcggagaaagctgtac
ctggcagctctgccattggcttttgaagccctcatacctaatctagatgaagtggaccac
ctgagctgtattaaagcaaaaaagctgttagagaccaagccagagttcttaaagtggttt
gttgtacttgaagaaacaccatgggatgccaccagccacattgacaacatggaaaatgag
cggattccctttgacttgatggatactgtccctgctgagcagttgtatgagacccacttg
gagaagctgaggaacgagaggaagagagctgagatgcgaagggctttcaaagaaaacctg
gagacctctcctttcataactcctgggaaaccttgggaagaagctcgtagttttattatg
aatgaagacttctaccagtggctggaagaatctgtgtacatggacatctatggcaagcac
caaaagcagattatagaccgagcaaaggaagagttccaagagttgcttttggagtactca
gaattgttttatgagctggagctggacgctaagcccagcaaggagaagatgggtgtcatc
caggatgttctgggcgaagagcagagatttaaagcattgcagaagctccaagcagagcgt
gatgccctcattctgaagcacatccattttgtgtaccacccgacgaaggagacatgccca
agctgtccagcttgtgtagatgctaagattgaacacttgatcagttctcgctttatcaga
ccatctgatcggaatcagaagaactctctgtctgacctcaatattgataggatcaatttg
gttatcttaggcaaagatggccttgcccgagagttggccaatgaaattcgagctctttgt
acaaatgatgacaagtatgtaatagatggtaaaatgtatgagctttctctgaggccaata
gaggggaatgtccggcttcctgtgaactctttccagacaccaaccttccaaccccatggc
tgtctctgcctttacaattcaaaggagtcactgtcctatgtggtggagagtatagagaag
agcagagagtctacactgggcaggcgggataatcatttagtccaccttcccttgacctta
attttagttaacaagagaggggacacaagtggagagactctgcacagcttgatacagcaa
ggtcagcagattgccagcaaacttcagtgtgtctttcttgatccggcttctgctggcatt
ggttatggacgcaacattaatgagaagcagatcagtcaagttctgaaaggactcctggac
tccaagcgcaacttaaacctggttagctccactgcaagtatcaaagatttggctgatgtg
gaccttcgaattgtcatgtgtctgatgtgtggtgatccctttagtgcagatgacgttctc
tctcctgtcctgcaatcccaaacttgtaaatcttcccactgtgggagcagcaactctgtt
ttacttgaacttccaattggactacacaagaagcgcattgagctgtctgttctttcatac
cattcctcatttagcatccgaaagagccggttggttcatgggtacattgttttttattca
gccaaacgtaaggcctccttggcaatgttacgtgcctttctttgtgaagtgcaggatatt
atccccatccagcttgtcgcactcactgatggcgctatagatgtcctagacaatgactta
agtcgagagcagctaacagagggagaggaaattgcacaagagattgacgggagattcaca
agcatcccttgtagccagccccagcataaacttgagctctttcatcccttttttaaagat
gtggtggagaaaaagaacataattgaggccacacatatgtatgataatgtagctgaggcc
tgcagcaccactgaggaagtgttcaactcccccagagctggctcacccctctgcaactca
aacttacaggactcagaagaagatgtggagcctccatcataccacctgtttcgggaagat
gcgacattgccctccctgtccaaagatcattccaagttctctatggaactggagggaaat
gacgggctatctttcataatgagcaattttgagagtaaactgaacaacaaagtacctccc
ccagtcaaaccaaagcctcctgtgcattttgatatcacaaaagatctttcttacttagac
caaggccatcgggagggacagaggaaatctatgtcttctagcccctggatgcctcaggat
gggtttgatccttctgactacgcagagcccatggatgctgtggtcaagccaaggaatgag
gaagaaaacatatactcggtgccccacgacagcacccagggcaagatcattaccattcgg
aacatcaacaaagcccagtccaatggcagtggtaatggttctgacagtgagatggacaca
agttccctagagcgaggccgcaaggtatctgcagtgagtaagcctgtgctgtacaggaca
agatgcactcgcctggggcggtttgctagttaccgtaccagcttcagtgtcgggagtgat
gatgagctgggacccatccgaaagaaagaggaggaccaggcatcccaaggttataaaggg
gacaatgctgtcattccatatgaaacagatgaggaccccaggaggaggaatatccttcga
agtctaagaaggaacaccaagaaaccaaagcccaaaccccggccatccatcacaaaggca
acctgggagagtaactattttggggtgcccttaacaacagtggtgactccagagaaaccg
atacccattttcattgaaagatgcattgagtacatcgaagccacaggactaagcactgaa
ggcatctaccgggtcagtggaaacaagtcagaaatggaaagtttgcaaagacagtttgat
caagaccacaatctggacctggcagagaaagacttcactgtgaacactgtggcaggggcc
atgaagagttttttctcagagctaccagaccccctggtaccatacagcatgcagattgac
ttggtggaagctcacaaaatcaacgacagggaacagaagctgcatgctctgaaggaagtg
ctgaagaagttcccgaaggaaaaccatgaagtcttcaaatatgtcatctcccacctgaac
aaagtcagccacaacaacaaggtgaatcttatgaccagtgagaacctgtccatctgcttc
tggcccacgctgatgcggcctgacttcagcagcatggacgcgctcacagccacgcgctcc
taccagaccatcatcgagctcttcatccagcagtgccccttcttcttctacaaccggccc
atcagcgagcctccaggggctgcgcctggctccccttcagccatggctcccactgttccc
ttcctcacctctacacctgctaccagtcagccatcacctccccagtcacctcctccaacc
cctcagtccccaatgcagccattgctgtcctctcagctccaagccgaacacacgctgtga

DBGET integrated database retrieval system