KEGG   Mus musculus (house mouse): 11856
Entry
11856             CDS       T01002                                 
Symbol
Arhgap6, AI504284, RhoGAPX-1
Name
(RefSeq) Rho GTPase activating protein 6
  KO
K20631  Rho GTPase-activating protein 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11856 (Arhgap6)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    11856 (Arhgap6)
SSDB
Motif
Pfam: RhoGAP
Other DBs
NCBI-GeneID: 11856
NCBI-ProteinID: NP_033837
MGI: 1196332
Ensembl: ENSMUSG00000031355
Vega: OTTMUSG00000019560
UniProt: O54834
Position
X:167578091..168087436
AA seq 987 aa
MSAQSLLHSVFSCSSPASGGTASAKGFSKRKLRQTRSLDPALIGGCGSEMGAEGGLRGST
VSRLHSPQLLAEGLGSRLASSPRSQHLRATRFQTPRPLCSSFSTPSTPQEKSPSGSFHFD
YEVPLSRSGLKKSMAWDLPSVLAGSGSASSRSPASILSSSGGGPNGIFSSPRRWLQQRKF
QPPPNSRSHPYVVWRSEGDFTWNSMSGRSVRLRSVPIQSLSELERARLQEVAFYQLQQDC
DLGCQITIPKDGQKRKKSLRKKLDSLGKEKNKDKEFIPQAFGMPLSQVIANDRAYKLKQD
LQREEQKDASSDFVSSLLPFGNKKQNKELSSSNSSLSSTSETPNESTSPNTPEPAPRARR
RGAMSVDSITDLDDNQSRLLEALQLSLPAEAQSKKEKARDKKLSLNPIYRQVPRLVDSCC
QHLEKHGLQTVGIFRVGSSKKRVRQLREEFDRGVDVCLEEEHSVHDVAALLKEFLRDMPD
PLLTRELYTAFINTLLLEPEEQLGTLQLLIYLLPPCNCDTLHRLLQFLSIVARHADDNVS
KDGQEVTGNKMTSLNLATIFGPNLLHKQKSSDKEYSVQSSARAEESTAIIAVVQKMIENY
EALFMVPPDLQNEVLISLLETDPDVVDYLLRRKASQSSSPDILQTEVSFSMGGRHSSTDS
NKASSGDISPYDNNSPVLSERSLLAMQEDRARGGSEKLYKVPEQYTLVGHLSSPKSKSRE
SSPGPRLGKEMSEEPFNIWGTWHSTLKSGSKDPGMTGSYGDIFESSSLRPRPCSLSQGNL
SLNWPRCQGSPTGLDSGTQVIRRTQTAATVEQCSVHLPVSRVCSTPHIQDGSRGTRRPAA
SSDPFLSLNSTEDLAEGKEDVAWLQSQARPVYQRPQESGKDDRRPPPPYPGSGKPATTSA
QLPLEPPLWRLQRHEEGSETAVEGGQQASGEHQTRPKKLSSAYSLSASEQDKQNLGEASW
LDWQRERWQIWELLSTDNPDALPETLV
NT seq 2964 nt   +upstreamnt  +downstreamnt
atgtccgcgcagagcctgctgcacagtgtcttctcctgctcctcgcccgcgtcgggcggc
acggcctcggccaagggattctccaaaaggaagctgcgccagacgcgcagcctggaccca
gctctgatcggtggctgcgggagcgagatgggcgccgagggcggcctgcggggctccaca
gtaagccgcctccattctccacagctcttagcagagggtctcggttcccgcttagcttct
tctccccggagtcagcaccttcgggctacccggttccagactccgagacctctgtgctcg
tctttttccacaccaagtaccccgcaagaaaagtcgccttctggcagcttccactttgac
tacgaggtcccactgagtcgcagtggtctcaagaagagcatggcctgggacttgccttct
gtcctggccgggtccgggtccgctagtagccgcagtcccgcaagcatcctcagttcctcc
gggggaggccccaatggcatcttctcttctcctaggagatggctccagcagaggaagttc
cagcctccacctaacagtcgcagtcacccttacgtcgtgtggaggtccgagggtgacttc
acctggaacagcatgtctggtcgtagcgtgcgcctgaggtcagtccccatccagagcctc
tcagagctggagcgggcacgactgcaggaagtggctttttatcagttgcagcaggactgt
gacctgggctgtcagatcaccatccccaaagatggacaaaagagaaagaaatctttgaga
aagaaactggattcactagggaaggaaaagaacaaagacaaagaattcatcccacaggca
tttggaatgcccttatcccaagtcattgctaatgaccgggcatataaactgaagcaagac
ttgcagagggaggagcagaaggatgcatcatcggattttgtgtcttccctcctcccattt
gggaataaaaaacaaaacaaagaactctcaagcagtaactcatctctcagctcaacctca
gaaacaccaaatgagtctacatcaccgaatactccagaaccagctcctcgggccaggaga
aggggcgccatgtccgtggattccatcactgatctggatgacaaccagtctcgactccta
gaagctttacaactctccttgcctgctgaggctcagagtaaaaaagaaaaggccagagat
aagaagctgagtctgaatcctatttacaggcaggtccccaggctggtggacagctgctgt
caacatctggaaaaacatggcctccagacagtggggatattccgagttggaagctcaaag
aagagagtaagacaattgcgtgaagaatttgaccgtggggttgatgtctgtctggaagag
gagcatagtgttcacgatgtggcagccttgttaaaggagttccttagagacatgcctgac
ccccttctcacaagggagctatacactgcatttatcaacactctcctgttggagcctgag
gaacaactgggcaccttgcaactcctcatttaccttctacctccctgcaactgcgacacc
ctccaccgcctcctacagttcctctccattgtggccaggcatgctgatgataatgtcagc
aaagatggacaagaggttactgggaacaaaatgacatctctgaacttagccactatattt
ggacccaacctgctccacaagcagaagtcatcagacaaagaatattctgttcagagctca
gccagagctgaggagagcacagccatcatagctgtggtacagaagatgattgaaaattat
gaagccttgttcatggttcccccagatctccagaatgaagtgctgatcagccttctagag
acagatccagatgttgtggactacttgctcagaagaaaggcttcccaatcctcgagccct
gacatacttcagacggaagtttccttttccatgggagggaggcattcatctacagattcc
aacaaagcctccagtggagacatctccccttatgacaacaactccccagtattgtctgag
cgctccctgctggctatgcaagaggacagggcccgggggggctcggagaagctttataaa
gtgccagagcagtatacactggtgggccacttgtcatcgccaaagtcaaagtcaagagaa
agttctcctggaccaaggcttggaaaagaaatgtcagaggagcctttcaatatctgggga
acttggcattcaacattaaaaagtggatccaaagacccaggaatgacaggctcttatggc
gacatttttgaaagcagctccctccgaccgaggccttgttctctttctcaagggaacctt
tccctgaactggcctcggtgtcaagggagcccgacagggctggacagtggcactcaggta
attcggaggactcagacggcggccaccgtggagcagtgcagtgtccaccttccggtgtca
cgtgtctgcagcactccccacatccaggacggcagcagggggaccaggcggcctgcagcc
agctctgatccatttttgtccctaaacagcacagaagatctagctgagggcaaggaggat
gttgcctggctgcaaagccaggcccgacctgtgtaccagagacctcaggagagtggaaaa
gatgacaggcgcccccctcctccttacccggggtcagggaagcctgccacaacctctgcc
cagctgccactagagcctcccctgtggaggctccagaggcatgaagaaggttcagaaaca
gctgtggaaggaggccagcaggcctcaggggagcatcagaccaggccaaaaaaactgagc
agcgcctactccctctcagccagcgagcaggacaaacagaacttaggggaagccagctgg
ctcgactggcagcgagagcggtggcagatctgggagcttctatcaactgataaccccgac
gccctcccggaaaccctagtataa

DBGET integrated database retrieval system