KEGG   Mus musculus (mouse): 11857
Entry
11857             CDS       T01002                                 

Gene name
Arhgdib, D4, Gdid, Gdid4, Ly-G, Ly-GDI
Definition
(RefSeq) Rho, GDP dissociation inhibitor (GDI) beta
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04722  Neurotrophin signaling pathway
mmu04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    11857 (Arhgdib)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    11857 (Arhgdib)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11857 (Arhgdib)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11857 (Arhgdib)
  Exosomal proteins of other body fluids (saliva and urine)
   11857 (Arhgdib)
  Exosomal proteins of colorectal cancer cells
   11857 (Arhgdib)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 11857
NCBI-ProteinID: NP_001288230
MGI: 101940
Ensembl: ENSMUSG00000030220
Vega: OTTMUSG00000023287
UniProt: Q61599
Position
6; 6 G1
AA seq 200 aa
MTEKDAQPQLEEADDDLDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVAD
PTVPNVTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVS
GLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDD
DKQDHLTWEWNLAIKKDWTE
NT seq 603 nt   +upstreamnt  +downstreamnt
atgacggagaaggatgcacagccacagctggaagaggcggacgacgacctggacagcaag
ctcaattataagccaccccctcagaagtccttgaaggagctgcaggagatggacaaggat
gacgagagtctaaccaagtacaagaaaacactgctgggagatgtccctgtggtagcagac
ccaacagttcccaacgtgactgttacccggcttagccttgtatgtgacagtgcaccagga
cccatcaccatggaccttactggcgatctcgaggccctcaaaaaggatacatttgtgcta
aaggaaggcattgaatacagggtgaaaattaacttcaaagtgaataaggatattgtgtct
ggcctgaagtatgttcaacacacataccggactggcatgagagtggataaagccacattc
atggttggcagctatgggccccgaccagaggagtacgaattcctcactccagtagaggaa
gctcccaagggcatgctggcccgaggcacttaccacaacaagtccttcttcacggatgac
gacaaacaggaccacctcacctgggaatggaacctggccattaagaaggattggacagaa
tga

DBGET integrated database retrieval system