KEGG   Mus musculus (house mouse): 11859
Entry
11859             CDS       T01002                                 
Symbol
Phox2a, Arix, Phox2, Pmx2, Pmx2a, Px2a
Name
(RefSeq) paired-like homeobox 2a
  KO
K09330  paired mesoderm homeobox protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11859 (Phox2a)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    11859 (Phox2a)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Phage_Mu_Gam
Other DBs
NCBI-GeneID: 11859
NCBI-ProteinID: NP_032913
MGI: 106633
Ensembl: ENSMUSG00000007946
UniProt: Q62066
Position
7:101467520..101471933
AA seq 280 aa
MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALG
ALRDHQPAPYSAVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTR
EELALKIDLTEARVQVWFQNRRAKFRKQERAASAKGAAGATGAKKGEARCSSEDDDSKES
TCSPTPDSTASLPPPPAPSLASPRLSPSPLPAALGSGPGPQPLKGALWAGVAGGGGGGPG
TGAAELLKAWQPAEPGPGPFSGVLSSFHRKPGPALKTNLF
NT seq 843 nt   +upstreamnt  +downstreamnt
atggactactcctacctcaattcgtacgattcgtgcgtggcggccatggaggcgtccgcc
tacggtgacttcggcgcctgcagccagcctggaggcttccaatacagtcccctgcggcct
gccttccccgccgctgggccaccttgccccgcgctcggctcctccaactgtgcgcttggc
gccctacgcgaccaccagcccgcaccctactcggcagttccctacaagttcttcccggag
ccgtccggcctgcatgagaagcgcaagcagcggcgcatccgcacaacgttcacgagtgct
cagctcaaggagttggagcgcgtcttcgccgagacccactaccccgacatttacactcgc
gaggaactggcgctcaagatcgacctcactgaggctcgcgtgcaggtctggttccagaac
cgccgggccaagttccgcaaacaggagcgcgcggccagcgccaaaggcgcggcgggagcg
acgggcgccaaaaagggcgaggcgcgttgctcgtcggaggacgacgactccaaggagtcc
acgtgcagccccacgcccgacagcaccgcgtcgctgccgccgccgcctgcacccagcctg
gccagcccgcgtctgagccccagccctctgcccgccgcgctgggctccgggcccgggccc
cagccgctcaagggagcgttgtgggcaggggtggcgggcggtggaggtggcggccccggc
acgggcgcagcggagctgcttaaggcctggcagccggcggaacccgggccaggtcccttc
tctggagttctgtcctcctttcaccggaagcccggccccgccctgaagacaaacctcttc
tag

DBGET integrated database retrieval system