KEGG   Mus musculus (mouse): 11861Help
Entry
11861             CDS       T01002                                 

Gene name
Arl4a, AI467555, Arl4
Definition
(RefSeq) ADP-ribosylation factor-like 4A
  KO
K07945  ADP-ribosylation factor-like protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    11861 (Arl4a)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arl4/Arl7
    11861 (Arl4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Ras Roc SRPRB MMR_HSR1 G-alpha GTP_EFTU Gtr1_RagA ATP_bind_1 6PF2K AAA_28 RsgA_GTPase NTPase_1
Motif
Other DBs
NCBI-GeneID: 11861
NCBI-ProteinID: NP_001034604
MGI: 99437
Ensembl: ENSMUSG00000047446
Vega: OTTMUSG00000032944
UniProt: P61213
Position
12 B1; 12 18.06 cM
AA seq 200 aa AA seqDB search
MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK
VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITR
ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE
KLHDMIIKRRKMLRQQKKKR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggaatggactgtcagaccagacttccatcctgtccagcctgccgtcctttcagtcc
tttcacattgttattctgggtttggactgtgctggaaagacaacagttttatacaggctg
cagttcaacgaatttgtaaataccgtacctaccaaaggatttaacactgagaaaattaag
gtaaccttgggcaattccaaaacagtcacttttcacttctgggatgtaggtggtcaagag
aagttaagaccactgtggaagtcatacacccgatgcacagatggtattgtgtttgtggtg
gactctgtcgatgttgagagaatggaagaagccaaaactgaacttcataaaataactagg
atatccgaaaatcagggagtccctgtgcttatagttgctaataaacaagacctgaggaac
tcgctctctctctcagagattgagaagttgttagcaatgggggaactgagctcatcgact
ccttggcatttgcagcccacctgtgcaatcataggagatgggctaaaggaaggactcgag
aaactacatgatatgataattaaaaggagaaaaatgttgcggcaacagaaaaagaagaga
tga

DBGET integrated database retrieval system