KEGG   Mus musculus (mouse): 11863Help
Entry
11863             CDS       T01002                                 

Gene name
Arnt, D3Ertd557e, Drnt, ESTM42, Hif1b, W08714, bHLHe2, mKIAA4051
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu04934  Cushing syndrome
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    11863 (Arnt)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11863 (Arnt)
   05204 Chemical carcinogenesis
    11863 (Arnt)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    11863 (Arnt)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11863 (Arnt)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11863 (Arnt)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    11863 (Arnt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4
Motif
Other DBs
NCBI-GeneID: 11863
NCBI-ProteinID: NP_001032826
MGI: 88071
Ensembl: ENSMUSG00000015522
Vega: OTTMUSG00000016472
UniProt: P53762 Q3ULM2
Structure
PDB: 

Position
3 F2.1; 3 40.74 cM
AA seq 791 aa AA seqDB search
MAATTANPEMTSDVPSLGPTIASGNPGPGIQGGGAVVQRAIKRRSGLDFDDEVEVNTKFL
RCDDDQMCNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKTREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIP
RSQLGPTANLSLEMGTGQLPSRQQQQQHTELDMVPGRDGLASYNHSQVSVQPVASAGSEH
SKPLEKSEGLFAQDRDPRFPEIYPSITADQSKGISSSTVPATQQLFSQGSSFPPNPRPAE
NFRNSGLTPPVTIVQPSSSAGQILAQISRHSNPAQGSAPTWTSSSRPGFAAQQVPTQATA
KTRSSQFGVNNFQTSSSFSAMSLPGAPTASSGTAAYPALPNRGSNFPPETGQTTGQFQAR
TAEGVGVWPQWQGQQPHHRSSSSEQHVQQTQAQAPSQPEVFQEMLSMLGDQSNTYNNEEF
PDLTMFPPFSE
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgactacagctaacccagaaatgacatcagatgtaccatcgctgggtcccacc
attgcttctggaaaccctggacctgggattcaaggtggaggagctgttgtacagagggct
attaagcgacggtcagggctggattttgatgatgaagtagaagtgaacactaaatttttg
agatgcgatgatgaccagatgtgtaatgacaaagagcggtttgccaggtcggatgatgag
cagagctctgcggataaagagagacttgccagggaaaatcatagtgaaatagaacggcgg
cgacggaacaagatgacagcttacatcacagaactgtcagacatggtacctacatgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggccgtttctcacatgaag
tccttgaggggaactggcaacacatctactgatggctcctacaagccatctttcctcact
gatcaggaactgaaacatttgatcttggaggcagcagatggctttctgtttattgtctcc
tgtgagactggacgggtggtgtatgtctctgactcagtgactcccgttttgaaccagcca
cagtctgaatggttcgggagcacactgtatgatcaggtgcacccagatgatgtggataaa
cttcgagagcagctctctacatcagaaaatgccctaacagggcgggtcctggatctgaag
actggaacagtgaaaaaggaaggccagcagtcttccatgaggatgtgcatgggctcacga
aggtcgttcatctgccgcatgaggtgtggtactagctccgtggaccctgtttccatgaat
agactgagctttttgaggaacagatgcaggaatgggcttggctctgtgaaggaaggagaa
cctcactttgtggtagtccactgcacaggctacatcaaggcctggccaccagcaggtgtc
tccctcccagatgatgacccagaggctggccaggggagcaaattctgcctagtggccatt
ggcaggctgcaggtaactagttctcccaactgtacagacatgagtaacatttgtcagcca
acagagttcatctcccgacacaacattgaagggatattcacttttgtagaccatcgttgt
gtggctactgttggctaccagccacaggagctcttagggaagaatattgtagaattttgt
catcctgaagaccaacaacttctaagagacagctttcagcaggtggtgaaattaaaaggt
caggtgctgtccgtcatgttccgattccgatctaagacccgagaatggctgtggatgaga
acgagctcctttaccttccaaaacccttattcagatgaaattgagtatattatctgcacc
aacaccaatgtgaagaactctagccaggaaccacggcctacactgtccaacaccatccca
aggtcacagctaggtccgacagccaatttatccctagagatgggtacagggcagctgcca
tccaggcagcagcagcagcagcacacagaactggatatggtaccaggaagagatgggctg
gccagctataatcattcccaggtttctgtccagcctgtggcaagtgcaggatcagaacac
agcaagccccttgagaagtcagaaggtctctttgcacaggacagagatccaaggtttcca
gaaatctatcccagcatcactgcagatcagagtaaaggcatctcctccagcactgtccct
gccacccaacagctgttctcccagggcagctcattccctcctaacccccggccggcagag
aatttcaggaatagtggtcttacccctcctgtaaccattgtccagccatcatcttctgca
gggcagatactggcccagatttcacgtcactccaaccctgcccagggatcagcgccgacc
tggacctctagctcccgcccaggctttgccgcccagcaggtgcccacccaggctacagcc
aagactcgttcttcccaatttggtgtgaacaactttcagacttcttcctccttcagtgct
atgtctcttccgggtgctcccactgcctcatctggtactgctgcctaccctgctctcccc
aaccgtggctccaactttcctcctgagactggacagaccacaggacagttccaggcccgg
acagcagagggcgtgggtgtctggccacagtggcagggccagcagccccatcatcggtct
agttccagtgagcagcatgttcagcagacacaagcacaagcacctagccagcctgaggtc
tttcaagaaatgctgtccatgctgggagaccaaagcaacacctacaacaatgaagaattt
cctgatctaactatgtttccccccttttccgaatag

DBGET integrated database retrieval system