KEGG   Mus musculus (house mouse): 11864
Entry
11864             CDS       T01002                                 
Symbol
Arnt2, Hif-2b, bHLHe1, mKIAA0307
Name
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11864 (Arnt2)
   05202 Transcriptional misregulation in cancer
    11864 (Arnt2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    11864 (Arnt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11864 (Arnt2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    11864 (Arnt2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 11864
NCBI-ProteinID: NP_031514
MGI: 107188
Ensembl: ENSMUSG00000015709
UniProt: Q61324
Position
7:complement(83895482..84060949)
AA seq 712 aa
MATPAAVNPPEMASDIPGSVALPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWLLIRTSSFTF
QNPYSDEIEYVICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASASGSQQIYSQGSPFPAGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNISQISRQLNQGQVAWTGSRPPFPGQPSKTQSSAFGIGSSHP
YPADPSSYSPLSSPAASSPSGNAYPSLANRTPGFAESGQSGGQFQGRPSEVWSQWQSQHH
GQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggcaaccccggccgccgtcaaccctccggagatggcgtcagacataccaggatctgtg
gccttgcctgttgcccccatggcagccaccggacaggtgagaatggcaggggccatgcct
gcccgaggaggaaagcgtcgatccggaatggacttcgatgacgaagatggtgaaggtccc
agtaaattctcaagagagaaccacagtgagattgagcggcgcaggcggaacaagatgact
caatatattacggaactctccgacatggttcccacctgcagtgcactggctaggaagcca
gacaagctgaccatcctgcgcatggcggtctcgcacatgaagtccatgaggggcaccggc
aacaaatcgactgacggcgcctacaagccttccttcctcactgagcaggaactgaagcat
ctcatcctggaagccgctgatggatttctgtttgtggtggcagctgagacagggagagtc
atctacgtgtctgattcggtcactcctgtcctgaaccagccacagtcagagtggtttggg
agcacgctttatgagcaggtgcaccctgatgacgtggagaaactgagggaacagctgtgc
acttcggaaaactccatgacaggccgcatcctggacctgaagactgggacagtgaagaag
gagggacagcagtcatccatgcgcatgtgtatgggctctcggcgctccttcatctgtagg
atgaggtgtggaaacgctcccttggaccacctgcctttgaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtgaaagaaggagaagcccagtatgctgtggtc
cactgcacaggttacatcaaggcttggccaccagcaggaatgaccatacccgaagaagac
gctgatgtcggacaaggcagtaaatattgcctcgtggcaattgggaggctccaggtgacc
agctctcctgtgtgcatggacatgagcggcatgtcagtgcccacagagttcctgtcacgg
cacaactctgatgggattatcacgtttgtggaccccagatgcatcagtgtgattggctac
cagccccaggaccttctgggaaaggatattttggaattttgccaccctgaggatcagagc
cacctacgggagagcttccaacaggtggttaagctgaagggccaagtgctgtcggtcatg
tatcggttccgcaccaagaaccgggagtggctgttgatccgtaccagcagcttcaccttc
cagaacccctactctgatgagatcgagtacgtcatctgcaccaacaccaatgtcaagcaa
cttcagcaacagcaggcagaactggaggtacatcagcgagatgggctgtcgtcatatgac
ttatctcaggtcccagtacccaacctacccgctggtgttcacgaggccgggaagtctgtg
gaaaaggcagatgcaatcttctcccaagagagagaccctcgttttgctgagatgtttgca
ggcatcagtgcatctgagaagaagatgatgagctcagcctcagcatcaggcagccagcag
atctactcccaaggaagtccattccctgccgggcactcgggcaaggccttcagctcttcc
gtggtccatgtgcctggagtgaatgacattcagtcctcctcctcaacgggacagaacata
tcccagatctctcggcagctgaaccagggccaggtggcatggacaggcagccgtccaccg
ttcccagggcagcccagcaagacgcagtcatctgccttcggaattggatcaagccaccct
tacccggctgacccttcatcctacagtcctctctccagcccagctgcctcctcaccaagt
ggaaacgcataccccagtcttgccaacaggactccagggtttgctgagagtggacagagt
ggcgggcagttccagggccggccctcggaggtctggtcccagtggcagagccagcatcac
ggacagcagagcggtgagcagcactcgcatcagcagcctggccagactgaagtgttccag
gacatgctacccatgccgggcgacccgacgcaggggactggcaactataacatcgaggac
tttgctgacctgggcatgttccctccattttctgagtag

DBGET integrated database retrieval system