KEGG   Mus musculus (mouse): 11865
Entry
11865             CDS       T01002                                 

Gene name
Arntl, Ar, Arnt3, BMAL1b, Bma, Bmal1, MO, MOP3, bHLHe, bHLHe5, bmal1b'
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator-like
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04710  Circadian rhythm
mmu04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    11865 (Arntl)
  09159 Environmental adaptation
   04710 Circadian rhythm
    11865 (Arntl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11865 (Arntl)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    11865 (Arntl)
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 11865
NCBI-ProteinID: NP_031515
MGI: 1096381
Ensembl: ENSMUSG00000055116
Vega: OTTMUSG00000060257
UniProt: Q9WTL8 Q3UHZ2
Structure
PDB: 
4F3L

Position
7 F1; 7 59.17 cM
AA seq 626 aa
MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSATDYQESMDTDKDDPHGR
LEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFASTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHMVPQPANGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTAPPHSMDSMLPSGEGGPKRTHPT
VPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKI
LNGGTPDIPSTGLLPGQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggcggaccagagaatggacatttcctcaaccatcagcgacttcatgtctccgggcccc
accgacctactctccggttccctgggcaccagtggtgtggactgcaatcgcaagaggaaa
ggcagtgccactgactaccaagaaagtatggacacagacaaagatgaccctcatggaagg
ttagaatatgcagaacaccaaggaaggatcaagaatgcaagggaggcccacagtcagatt
gaaaagaggcgtcgggacaaaatgaacagtttcattgatgaattggcttctttggtacca
acatgcaatgcaatgtccaggaagttagataaactcaccgtgctaaggatggctgttcag
cacatgaaaactttgagaggtgccaccaacccatacacagaagcaaactacaagccaaca
tttctatcagatgacgaactgaaacacctaattctcagggcagcagatggatttttgttt
gtcgtaggatgtgaccgagggaagatcctctttgtctccgagtctgtcttcaagatcctc
aattatagccagaatgaccttattggccagagcttgtttgactacctgcatccaaaagat
attgccaaagttaaggaacagctatcttcctcggacactgcgccccgggagcgactcatt
gatgccaagactggacttccggttaaaacggatataacccctgggccctcccggctatgc
tctggagcccgccgctctttcttctgtagaatgaagtgcaacaggccttcagtaaaggtg
gaagataaggacttcgcctctacctgttcaaagaaaaaagcagatcgaaaaagcttctgc
acaatccacagcacaggctatttgaaaagctggccacccacgaagatggggctggacgaa
gacaatgagccagacaacgagggctgcaacctcagctgcctcgttgcaatcgggcgcctg
cactcgcacatggttccacaaccagcgaacggggaaatacgggtgaaatctatggagtac
gtttctcgacacgcaatagatgggaaatttgtttttgtagatcagagggcgacagctatt
ttggcgtatctaccacaggaacttctaggtacatcatgttatgagtattttcatcaagac
gacataggacacctcgcagaatgtcacaggcaagttttacagacaagagaaaagatcaca
actaattgctataagtttaagatcaaagatggttcttttatcacgctacgaagtcgatgg
ttcagtttcatgaacccgtggaccaaggaagttgaatacattgtctcaaccaacactgtt
gttttagccaatgtcctggaaggcggggacccaaccttcccgcagctaacagcacccccc
cacagcatggacagcatgctgccctctggagaaggtggcccaaagaggactcatcccact
gtcccaggcattccagggggaaccagagccggagcaggaaaaataggtcgaatgatcgcg
gaggaaatcatggaaatccacaggataagagggtcatcgccttccagctgtggctccagc
ccgctgaacatcacaagtacgcctccccctgatgcctcttctccaggaggcaagaagatt
ctaaatggagggactccagacattccttccactggactattaccagggcaggctcaggag
accccagggtatccctattctgatagttcttctattcttggtgagaacccccacataggc
atcgatatgatagataacgaccaaggatcaagtagtcccagtaacgatgaggcagcaatg
gctgtcatcatgagcctcttggaagcagatgcggggctgggtggccccgttgactttagt
gacttgccatggccgctgtag

DBGET integrated database retrieval system