KEGG   Mus musculus (house mouse): 11877
Entry
11877             CDS       T01002                                 
Symbol
Arvcf
Name
(RefSeq) armadillo repeat gene deleted in velocardiofacial syndrome
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Arm HEAT_EZ HEAT HEAT_2 Atx10homo_assoc
Other DBs
NCBI-GeneID: 11877
NCBI-ProteinID: NP_001258957
MGI: 109620
Ensembl: ENSMUSG00000118669
Vega: OTTMUSG00000026041
UniProt: P98203
Position
16:18166046..18225826
AA seq 962 aa
MEDCNVHSAASILASVKEQEARFERLTRALEQERRHVALQLERAQQPGMSSGGMVGSGQP
LPMAWQQLVLQEQSPGSQASLATMPEAPEVLEETVTVEEDPGTPTSHVSIVTSEDGTTRR
TETKVTKTVKTVTTRTVRQVPLGPDGLPLLDGGPPLGSFADGPLDRHYLLRGGGGPAATL
SRTYHSSGGGFPDGPESRDIPSYGSLSRGLGVRPPRTGLLGPGPGDGCFTLPGRREAFPM
GSESGPPSGRSLPEHFQAEPYGLEDDTRSLAADDEGGPDLEPDYSTATRRRPEYGRGLRA
RAFEDTADDAGELIEERPPFPAATAPLAQPERGSLGSLDRVVRRSPSVDSTRKEPRWRDP
ELPEVLAMLRHPVDPVKANAAAYLQHLCFENEGIKRRVRQLRGLPLLVALLDHPRAEVRR
RACGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNEVRELVTGTLWNLSSYEPLK
MVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAEARR
RLRECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPG
IPGSTTSQRRRKDDASCFGGKKAKEEWFHQGKKDAEMDRNFDTLDLPKRTEAAKGFELLY
QPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWTWATYIRATVRKERGLPVLVELLQ
SETDKVVRAVAIALRNLSLDQRNKDLIGSYAMTELVRNVRNAQAPAHPSAHLEEDTVVAV
LNTIHEIVSDSLDNARSLLQARGVPALVALVASSQSVREAKAASHVLQTVWSYKELRGAL
QRDGWTKSRFQSASTAKGPKGTPSSGGFDDSTLPLVDKSLDGEKSNTRDVIPMDTLGPDG
YATVDRRERRTLGSDSTGDTSEKELLRPDPGRKAPPPGPSRPSVRLVDAVGDTKPQPVDS
WV
NT seq 2889 nt   +upstreamnt  +downstreamnt
atggaggactgcaacgtgcattcggccgccagcattttggcctcggtgaaggaacaggag
gcccgtttcgagcggctgacacgggcactagaacaagaacggcgccatgttgccctgcag
ctggagcgtgcccagcagcctggcatgagcagtggtggtatggtgggcagtgggcagccc
ctgccaatggcctggcagcagctggttctgcaggagcagagcccgggtagccaggcatcg
ctggccacgatgccagaggcacccgaggtactggaggagacagtgactgtggaggaagac
cctggcacccccacctctcacgtgtccatcgtcacatcagaagatggtacaacccggcgg
actgagactaaggtcactaagacggtcaagactgtgaccacaaggacagtacgccaggtg
cctttgggcccagatggactccccttgctggacggcggccctccacttggctcttttgct
gacgggcccctggaccggcattacctacttcgtggtggtggtggtccagcagccacactc
tcccgaacctaccacagcagtggaggtggctttcccgatggccccgagtcccgtgatatt
ccaagctatggcagcttgtcccgagggctcggggtacggccaccacgtactggcctcctg
ggcccaggacctggtgatggctgtttcacactgcctggccgccgagaagccttccccatg
ggctctgaatccggaccaccaagcggccgctctctgcctgagcatttccaagctgaacca
tatggcctggaggatgatacacggagcctggctgcggatgatgagggtggccccgacctg
gagcctgactatagcacggcaacccggagaagacctgagtacgggcggggccttcgtgcc
agggcctttgaagacacagcagatgatgctggtgagctgatagaagagcgtcccccattt
ccagcagcaacagcccctctggcccagcctgagaggggcagcctgggcagcttggaccga
gtagtgcggcgctcaccttcagtggatagcacccgcaaggagccacgctggcgggacccc
gagctgccagaggtgttggccatgctgcggcaccctgtggaccctgtgaaagccaatgct
gcagcctacctgcagcacctctgctttgagaacgagggtattaagcggcgagtgcggcag
ctgcgtgggctccccctgcttgtggcattactagatcaccctcgggctgaggtgcggcgc
cgggcctgtggggcactgcgcaacctctcctatggccgggatactgacaacaaggccgcc
atccgggactgcgggggcgtgccagccctggtgcgcctactgcgggcggcccgtgacaat
gaggtccgtgagctggtcactggcacactctggaacctgtcatcctacgagcccctgaag
atggtcatcattgaccacggcttacagactctgacccatgaggtcatcgtgccccattcc
ggctgggagcgagagcctaacgaagactcgaagccccgggatgccgagtggacaacagtc
ttcaagaacacatcaggctgcctgaggaatgtgagctcagatggtgcagaggcccggcgg
cgactccgtgagtgcgaagggctggtggacgctctcctacatgccctgcagtcagctgtg
ggcaggaaagacacagataataagtcagtagagaactgtgtgtgcatcatgcggaacctg
tcctaccacgtgcacaaagaagttccaggggctgacaggtaccaggaggcagagcctggg
atcccgggcagcacaacctcccagcgacggaggaaggatgacgccagctgctttggtggc
aagaaagcaaaagaggagtggttccatcaagggaagaaggatgcagagatggaccggaac
tttgacacactggacctgcctaaacgaacggaggctgcaaaaggcttcgagctgctgtac
cagccggaggtggtacgtctctacctctcactccttacggagagccggaacttcaacacc
ctggaagctgcagccggtgccctgcaaaacctcagtgctggcaactggacgtgggccacg
tacatccgtgccacagtgcgcaaggaacgtgggctgccagtactggtggaactgctacag
tctgagaccgacaaggtggtgcgcgctgtagccatcgcgctgcgcaacctctcactagac
cagcggaacaaagacctcatcgggagctatgccatgacagagctggttcggaatgttcgc
aatgcacaggctcccgctcaccccagtgcccacctggaggaggatactgtggttgccgtg
ctcaacaccatccatgagatcgtgtccgacagcctggacaatgctcgctccctcctgcag
gcccgtggtgtgcctgccctggtagcacttgtggcctccagccagtcagtgcgggaggcc
aaggcagcatcacacgtgctacagactgtatggagctacaaggagctgcgtggagccctg
cagagggatggctggacgaagtcacgcttccagtctgctagcactgccaaaggacccaaa
gggacaccaagttctggcggctttgatgacagcacactgccactggtagacaagagcctt
gatggggagaagtcaaacacccgggatgtgatccccatggatacccttggtccagatggt
tacgccacagttgaccggagggagaggaggacactgggcagtgactccacaggggacacc
tctgagaaagaactattgagacccgatcctggcaggaaggcccctccgcctgggcccagc
aggccctcggtcaggctggtggacgccgtgggggacactaagcctcagcctgttgactcc
tgggtctag

DBGET integrated database retrieval system