KEGG   Mus musculus (mouse): 11886
Entry
11886             CDS       T01002                                 

Gene name
Asah1, 2310081N20Rik, AC, Asah
Definition
(RefSeq) N-acylsphingosine amidohydrolase 1
  KO
K12348  acid ceramidase [EC:3.5.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04071  Sphingolipid signaling pathway
mmu04142  Lysosome
Module
mmu_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    11886 (Asah1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    11886 (Asah1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11886 (Asah1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11886 (Asah1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11886 (Asah1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     11886 (Asah1)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C89
   11886 (Asah1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11886 (Asah1)
Motif
Pfam: CBAH NAAA-beta AAT HP_OMP
Other DBs
NCBI-GeneID: 11886
NCBI-ProteinID: NP_062708
MGI: 1277124
Ensembl: ENSMUSG00000031591
Vega: OTTMUSG00000022574
UniProt: Q9WV54 Q78P93
Position
8; 8 A4
AA seq 394 aa
MRGQSLLTWVLAAAVTCAQAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKR
WHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIAD
VTGIPLGEIISFNIFYELFTMCTSIITEDEKGHLLHGRNMDFGIFLGWNINNNTWVVTEE
LKPLTVNLDFQRNNKTVFKATSFVGYVGMLTGFKPGLFSLSLNERFSINGGYLGILEWMF
GRKDAQWVGFITRSVLENTTSYEEAKNTLTKTKIMAPVYFILGGKKSGEGCVITRERKES
LDVYELDPKHGRWYVVQTNYDRWKNTLFIDDRRTPAKKCLNHTTQKNLSFATIYDVLSTK
PVLNKLTVFTTLMDVTKGQFESHLRDCPDPCIGW
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgcggggccaaagtcttctcacctgggtcctagccgcggcagtcacctgcgcccaggca
caggatgtgccgccgtggacagaagattgcagaaaatcaacgtatcctccttctggacca
acctatagaggaccagttccgtggcacaccataaatcttgatttaccaccctacaaaaga
tggcatgaattattggctcaaaaggcaccagcgttgaggattttagtgaattccataacg
agtttagtgaatacatttgtgccaagtggaaaactaatgaagatggtggatcaaaagctg
cctggtatgattggcagccttcctgacccttttggagaggaaatgaggggaattgcagat
gttactgggattcctctaggagagattatttcattcaacattttctatgaattgtttacc
atgtgtacatcaatcataactgaagatgagaaaggtcatttactacatgggagaaacatg
gattttggaatatttcttgggtggaatataaataataacacttgggttgtcacagaagaa
ttaaagcccttaacagtgaatttggacttccaaagaaacaataagactgttttcaaggct
acaagttttgttggatatgtgggcatgttgacaggattcaaaccaggactgttcagtctt
tcactaaatgaacgtttcagtataaatggtggttatctgggtatcctagaatggatgttc
ggaaggaaagatgcccagtgggtagggtttatcactcgatcagttctggaaaacaccaca
agttatgaagaagccaagaacacactgaccaagaccaagataatggcgccagtatatttt
atcctgggaggcaagaagtctggagagggttgtgtgatcacacgggaaagaaaagagtct
ttggatgtctatgaacttgatcctaagcatggcagatggtatgtggtacaaaccaattat
gacaggtggaaaaacaccttgtttattgatgaccgcagaacaccggccaagaagtgtcta
aatcacaccacacagaagaatctctcctttgctaccatctatgatgtcctatcaacaaaa
cctgtcctcaacaagctgactgtattcacaaccttgatggatgttaccaaaggtcaattt
gaaagtcaccttcgagattgcccagacccttgtataggctggtga

DBGET integrated database retrieval system