KEGG   Mus musculus (mouse): 11889Help
Entry
11889             CDS       T01002                                 

Gene name
Asgr1, ASGPR1, Asgr, Asgr-1, HL-1
Definition
(RefSeq) asialoglycoprotein receptor 1
  KO
K10063  asialoglycoprotein receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    11889 (Asgr1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   11889 (Asgr1)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Asialoglycoprotein receptor (ASGR) subgroup
    11889 (Asgr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_N Lectin_C AIP3 Tropomyosin_1
Motif
Other DBs
NCBI-GeneID: 11889
NCBI-ProteinID: NP_001278060
MGI: 88081
Ensembl: ENSMUSG00000020884
Vega: OTTMUSG00000006017
UniProt: P34927
Position
11 B3; 11 42.98 cM
AA seq 284 aa AA seqDB search
MTKDYQDFQHLDNDNDHHQLRRGPPPTPRLLQRLCSGSRLLLLSSSLSILLLVVVCVITS
QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHS
SLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKY
CQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQP
DNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggattatcaagatttccagcacctggacaatgataatgaccatcatcaactc
cggagagggccgcctcccactccacggctcttgcagcgactctgctctggatcccgcctc
ctcctgctctcctcgagcctcagcattctgttgctggtggttgtctgtgtgatcacatcc
caaaattcccaactccgggaagatctgctggctctaaggcagaatttcagcaacctcact
gtgagcactgaggaccaggtcaaggccctgagcacccagggaagtagtgtgggaagaaag
atgaagttagtggagtcgaagctggaaaaacagcagaaggatctgactgaagatcactcc
agtttgctactgcacgtgaagcagttagtgtctgacgtgcgaagcttgagctgccagatg
gctgcatttcggggcaatggctctgaaaggacctgctgccccatcaactgggtggagtat
gaaggcagctgctactggttctccagctctgtgaggccttggactgaagctgacaagtac
tgccagctggaaaatgcccatctggtggtggtgacctccagggatgagcagaacttcctc
cagcgccacatgggccccttaaacacttggattggcctaactgaccagaacgggccctgg
aaatgggtggatggaacagactacgagacaggcttccagaattggagaccagagcagcca
gataactggtacggacatgggcttggaggaggcgaggactgtgcccacttcacgacggat
ggccgctggaatgacgacgtctgcaggaggccctaccgctgggtctgtgagacaaagttg
gataaggctaattag

DBGET integrated database retrieval system