KEGG   Mus musculus (mouse): 11890
Entry
11890             CDS       T01002                                 

Gene name
Asgr2, A, AS, ASGPR2, Asg, Asgr, Asgr-2, HL-2
Definition
(RefSeq) asialoglycoprotein receptor 2
  KO
K10064  asialoglycoprotein receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    11890 (Asgr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    11890 (Asgr2)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Asialoglycoprotein receptor (ASGR) subgroup
    11890 (Asgr2)
SSDB
Motif
Pfam: Lectin_N Lectin_C
Other DBs
NCBI-GeneID: 11890
NCBI-ProteinID: NP_001300854
MGI: 88082
Ensembl: ENSMUSG00000040963
Vega: OTTMUSG00000006018
UniProt: P24721
Position
11 B3; 11 42.99 cM
AA seq 301 aa
MEKDCQDIQQLDSEENDHQLSGDDEHGSHVQDPRIENPHWKGQPLSRPFPQRLCSTFRLS
LLALAFNILLLVVICVVSSQSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAIL
TSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGS
CYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWV
DGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNIT
H
NT seq 906 nt   +upstreamnt  +downstreamnt
atggagaaggactgtcaagacatccagcagctggactctgaggagaatgaccatcagctc
agtggcgatgatgaacatggctctcatgtgcaggatcctaggatagaaaatccacactgg
aaagggcagcctctttccaggccctttcctcagcgcctctgctccacgttccgcctcagt
ctgctcgccctggccttcaacatcctcctgttggtggtcatctgtgtggtttcatctcaa
agcatacagctgcaagaagagtttcggaccctgaaagaaaccttcagcaacttttcctcc
agcaccctgatggagttcggggctctggacaccctcggaggtagcacaaacgccatactg
acttcctggttagcccaactggaggagaagcagcaacagctaaaggcagaccattccaca
ttgctctttcacctgaagcacttcccaatggatctgcgaaccctgacctgtcagctggcg
tacttccagagcaatggcacggaatgctgccctgttaactgggtggagttcgggggaagc
tgctactggttttctcgggatgggctcacctgggctgaggctgaccagtactgccagctg
gagaacgcccacctgctggtcatcaactccagggaggagcaggactttgttgtaaagcac
aggagccagtttcatatttggataggtcttaccgacagggatggctcctggaaatgggtg
gatggaactgattatagaagcaactacaggaattgggccttcactcagccagataactgg
cagggccatgaacagggtggaggtgaagactgtgctgaaatcctgtcagatggccattgg
aatgacaacttctgccagcaggtgaaccgctgggtatgcgaaaagagacggaacatcacc
cactag

DBGET integrated database retrieval system