KEGG   Mus musculus (mouse): 11898
Entry
11898             CDS       T01002                                 

Gene name
Ass1, AA408052, ASS, As, Ass-1, fo, fold
Definition
(RefSeq) argininosuccinate synthetase 1
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00029  Urea cycle
mmu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    11898 (Ass1)
   00220 Arginine biosynthesis
    11898 (Ass1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    11898 (Ass1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11898 (Ass1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     11898 (Ass1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11898 (Ass1)
SSDB
Motif
Pfam: Arginosuc_synth QueC tRNA_Me_trans
Other DBs
NCBI-GeneID: 11898
NCBI-ProteinID: NP_031520
MGI: 88090
Ensembl: ENSMUSG00000076441
Vega: OTTMUSG00000012079
UniProt: P16460 Q3UJ34
Position
2 B; 2 21.81 cM
AA seq 412 aa
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
IEDVSKEFVEEFIWPAVQSSALYEDRYLLGTSLARPCIARRQVEIAQREGAKYVSHGATG
KGNDQVRFELTCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKSPWS
MDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNSPDVLEIEFKKGVPVKVTNIKD
GTTRTTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAF
TMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIQKSQERVEGKVQVSVFKGQVYI
LGRESPLSLYNEELVSMNVQGDYEPIDATGFININSLRLKEYHRLQSKVTAK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgtccagcaagggctctgtggttctggcctacagtggtggcctggacacctcctgcatc
ctcgtgtggctgaaggaacaaggctatgatgtcatcgcctacctggccaacattggccag
aaggaagactttgaggaagccaggaagaaggcgctgaagcttggggccaaaaaggtgttc
attgaggatgtgagcaaggaatttgtggaagagttcatctggcctgctgtccagtccagt
gcactctacgaggaccgctatctcctgggcacctctctcgccaggccttgcatagctcgc
agacaggtggagattgcccagcgtgaaggggccaagtatgtgtctcacggcgccacggga
aaggggaatgaccaggtccgctttgagctcacctgctattcactggcaccccagattaag
gtcatcgctccctggaggatgcctgagttttacaaccggttcaagggccgaaatgatctg
atggagtatgcaaagcaacacggaatccccatccctgtcacccccaagagcccctggagt
atggatgaaaacctcatgcacatcagctatgaggctgggatcctggaaaaccccaagaat
caagcacctccgggtctctacacaaaaactcaggaccctgccaaagcacccaacagccca
gatgtccttgagatagaattcaaaaaaggggtccctgtgaaggtgaccaacatcaaagat
ggcacaacccgcaccacatccctggaactcttcatgtacctgaacgaagttgcgggcaag
cacggagtgggtcgcattgacatcgtggagaaccgcttcattggaatgaagtcccgaggt
atctacgagaccccagcagggaccatcctttaccacgctcatttagacatagaggccttc
acgatggatcgggaagtacgcaaaatcaagcagggcctgggcctcaaattcgcagagctc
gtatacacaggtttctggcacagccctgaatgtgaatttgttcgccactgtatccagaag
tcccaggagcgggtagaagggaaggtgcaggtgtctgtcttcaagggccaagtgtacatc
ctcggtcgggagtctccactttcactctacaatgaagagctggtgagcatgaacgtgcag
ggcgactatgagcccatcgacgccactggcttcatcaatatcaactcgctcaggctgaag
gagtaccatcgccttcagagcaaggtcactgccaaatag

DBGET integrated database retrieval system