KEGG   Mus musculus (mouse): 11899
Entry
11899             CDS       T01002                                 

Gene name
Astn1, Astn, GC14, mKIAA0289
Definition
(RefSeq) astrotactin 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Annexin_like FXa_inhibition ASTN_2_hairpin Tme5_EGF_like MACPF UPF0560
Other DBs
NCBI-GeneID: 11899
NCBI-ProteinID: NP_001192133
MGI: 1098567
Ensembl: ENSMUSG00000026587
Vega: OTTMUSG00000050031
UniProt: Q61137
Position
1; 1 H1
AA seq 1302 aa
MALAGLCALFACCWGPAAVLATAAGDVDPSKELECKLKSITVSALPFLRENDLSIMHSPS
ASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLF
HIHHQDGAPSLPGQDPTEEPQHESAEEELRILHISVMGGMIALLLSILCLVMILYTRRRW
CKRRRVPQPQKSASAEAANEIHYIPSVLIGGHGRESLRNARVQGHNSSGTLSIRETPILD
GYEYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNEKSGMDLTPGSDNAKLSLMNK
YKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSSTEAENDPQLT
FYTDPSRSRRRSRVGSPRSPVNKTTLTLISVTSCVIGLVCSSHVSCPLVVKITLHVPEHL
IADGSRFILLEGSQLDASDWLNPAQVVLFSQQNSSGPWAMDLCARRLLDPCEHQCDPETG
RREHRAAGECLCYEGYMKDPVHKHLCIRNEWGTNQGPWPYTIFQRGFDLVLGEQPSDKIF
RFTYTLGEGMWLPLSKSFVIPPAELAINPSAKCKTDMTVMEDAVEVREELMTSSSFDSLE
VLLDSFGPVRDCSKDNGGCSKNFRCISDRKLDSTGCVCPSGLSPMKDSSGCYDRHIGVDC
SDGFNGGCEQLCLQQMAPFPEDPTLYNILMFCGCIEDYKLGVDGRSCQLVTETCPEGGDC
GESREVPMNQTLFGEMFFGYNNQSKEVATGQVLKGTFRQNNFARGLDQQLPDGLVVASVP
LENQCLEEISEPTPDPDFLTGMVNFSEVSGYPVLQHWKVRSVMYHIKLNQAAISQAFSNA
LHSLDGATSRADFVALLDQFGNHYIQEAVYGFEESCSIWYPNKQVQRRLWLEYEDISKGN
SPSDESEERERDPKVLTFPEYIASLSDSGTKRMAAGVRMECQSKGRCPSSCPLCHVTSSP
ETPAEPVLLEVTRASPIYELVTNNQTQRLLQEATMSSLWCSGTGDVIEDWCRCDSTAFGA
DGLPTCAPLPQPVLRLSTVHEPSSNLVVLEWEHSEPPIGVQIVDYLIRQEKVTDRMDHSK
VETETVLSFVDDIISGAKAPCAMPSQVPDKQLTTISLIIRCLEPDTIYMFTLWGVDNTGR
RSRPSDVIVKTPCPVVDDVKAQEIADKIYNLFNGYTSGKEQQTAYNTLLDLGSPTLHRVL
YHYNQHYESFGEFTWRCEDELGPRKAGLILSQLGDLSSWCNGLLQEPKISLRRGSLKYLG
CRYSEIKPYGLDWSELSRDLRKTCEEQTLSVPYNDYGDSKDI
NT seq 3909 nt   +upstreamnt  +downstreamnt
atggctttagccgggctctgcgccctgttcgcctgctgctgggggccggctgcggtgctg
gccacagctgccggcgacgtggatccatccaaggagctggagtgcaagctcaagagcatc
actgtgtcggcactgcccttcctgcgcgagaacgacctgagcatcatgcacagtccctcg
gcctccgaacccaagcttctcttctccgtgcgcaatgacttcccgggagaaatggtcgtg
gtggacgacctagagaacacggagctaccctatttcgtgctggagatctcagggaataca
gaagacatccccctggtgcgctggaggcagcaatggctggagaatggcactttactcttt
catattcaccaccaagatggtgctccaagtctccctggacaagacccaactgaagaaccc
caacatgaatcagcagaggaagagctgaggatcctgcacatctcagtcatgggtggcatg
atcgctctgttgctatccatcttgtgcctggtgatgatcctgtacactcgcaggcgctgg
tgcaaacgtcgccgggttccccagccccagaagagtgccagtgcagaggcagcaaatgag
attcactacatcccatctgtgctgattggaggccatgggcgggaaagcttgcgcaatgcc
cgtgtgcagggccacaactccagtggcactctgagcattcgggagacacccatcctggat
ggctatgagtatgacatcacagacctgcgtcaccacctgcaaagggagtgtatgaatgga
ggggaggactttgccagtcaggtcacacgcactttggactccctacagggatgcaatgag
aagtctgggatggatctaacaccagggagtgacaatgccaagctttccctgatgaacaag
tataaagacaatatcatagccacaagccccgtggattctaaccaccagcaagccactctg
ctctcccacacctccagcagccagagaaagaggatcaacaataaagccagagctggttct
gccttcttgaaccctgaaggggactccagcacagaggccgaaaatgacccacagctgacc
ttctacacagacccctctcggagccggaggcgcagtcgagtgggctctccccgaagtcct
gtgaataagaccaccttgaccctgatcagtgtcaccagctgcgtgattggcctcgtgtgc
tcttctcatgtcagctgccctcttgttgtcaagatcaccctacacgtccctgagcacttg
atcgctgatgggagccgcttcatcctgctggaggggagccagctggatgccagtgactgg
ctgaaccctgcccaagtggttctcttctctcagcagaactccagcgggccctgggccatg
gacctctgtgcccggcggctcctggacccttgtgaacaccaatgtgaccccgaaactggt
aggcgggagcaccgggcagcgggggaatgcctgtgctatgaaggctacatgaaggatcct
gtccacaagcacctttgcattcggaatgaatgggggaccaaccaggggccttggccttac
acgatatttcagcgaggctttgacctggttttgggagagcaaccctctgataagatattc
agattcacctataccctcggggaaggcatgtggttacccctcagtaagagctttgtgatt
ccaccagccgaactagccatcaatccatcagcaaagtgtaagacggatatgactgtgatg
gaagatgctgtagaggtcagagaggagctgatgacatcatcatcctttgacagcctggag
gtcctattagactcctttgggccagtgcgtgattgcagcaaagataacggaggctgcagt
aagaattttcgctgcatttcagatcgcaagttggactctactggttgtgtgtgtccttca
ggactcagccctatgaaggacagctcaggctgctatgatcgccatatcggagtggactgc
tcagatggtttcaacggcggctgcgaacagctgtgtctccagcagatggcgccgttccca
gaggaccccaccttgtacaacatccttatgttctgcgggtgtatcgaagactacaagctt
ggtgtggatggacgctcttgccaacttgtcactgagacctgcccagagggaggtgactgt
ggggaaagcagagaggttcccatgaaccagactctctttggagaaatgttctttggctac
aacaaccagtccaaggaagtagccactggacaggtgctaaaaggaacattcagacagaac
aactttgctcgtggtttagaccagcaactgccggatggtcttgtggttgcctctgtccca
ctggagaatcagtgcctagaggaaatctcagagcccaccccagaccctgacttcttgact
gggatggtgaacttcagtgaagtgtctggatacccggtgctgcagcactggaaggttcgg
tctgtgatgtaccacatcaaactcaaccaagcagccatctcgcaggccttcagcaatgct
cttcactccttggatggggctacatctcgtgcagattttgtggctttgttggatcagttt
ggaaaccattacatccaggaagctgtctacggctttgaggaatcctgttctatatggtac
ccaaacaagcaagtccagcggagactctggctggaatatgaagacatcagtaaaggcaac
tctccatctgatgagtcggaggagcgggaaagggatcccaaggtgctgacattcccagaa
tacatcgctagcctgtcagactctggcaccaagcgaatggcagctggagtccggatggag
tgccagagcaagggacggtgtccctcatcctgtcctttatgtcatgtgacatccagccct
gaaacccctgctgagccagttctactggaagtgaccagagcatcccccatctatgaactg
gtgaccaataaccagacccagaggctcttacaggaagccaccatgagctctctctggtgt
tcagggaccggagatgtcattgaggactggtgccgatgcgactcgactgcttttggagca
gatggacttcctacctgtgcacccctcccacagcctgtgctgagactttccacagtacac
gagcccagcagtaacctcgtggtcctggagtgggaacattcagagccgccaattggggtg
cagattgtagactacctgatccggcaagagaaagtcactgaccggatggaccactccaaa
gtagagacggaaacagtgctgagctttgtagacgacatcatctctggagcaaaggctcca
tgtgccatgccgtctcaggtgccagacaaacagctcaccacgatttctctcatcatccga
tgcctggaacctgacaccatttacatgttcaccctctggggagtagataacacagggcga
cgttccaggccaagtgatgtgattgtgaagaccccatgtcctgtggtggatgatgtcaaa
gcccaagaaatagcagacaagatctacaatctcttcaatggctacaccagtggaaaggag
caacagactgcctacaacacccttctggatctgggttctcccactttgcaccgagtcctc
taccactataaccagcactatgagagttttggggaattcacctggcggtgtgaagatgag
ttaggacccaggaaagcaggcctcatcctttcccagcttggagatctgagcagctggtgc
aatggactccttcaggagcccaagataagcttgaggcgtggttcactcaagtacctgggc
tgccgctacagtgagatcaaaccctatggactggactggtcagagctcagtcgggacctc
aggaagacatgtgaagaacagaccctgagtgtcccctacaatgactacggggacagcaaa
gacatctag

DBGET integrated database retrieval system