KEGG   Mus musculus (mouse): 11905Help
Entry
11905             CDS       T01002                                 

Gene name
Serpinc1, AI114908, ATIII, At-3, At3
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1
  KO
K03911  antithrombin III
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    11905 (Serpinc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11905 (Serpinc1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11905 (Serpinc1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    11905 (Serpinc1)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   11905 (Serpinc1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   11905 (Serpinc1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   11905 (Serpinc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 11905
NCBI-ProteinID: NP_543120
MGI: 88095
Ensembl: ENSMUSG00000026715
Vega: OTTMUSG00000050830
UniProt: P32261 Q543J5
Position
1 H2.1; 1 69.75 cM
AA seq 465 aa AA seqDB search
MYSPGAGSGAAGERKLCLLSLLLIGALGCAICHGNPVDDICIAKPRDIPVNPLCIYRSPG
KKATEEDGSEQKVPEATNRRVWELSKANSRFATNFYQHLADSKNDNDNIFLSPLSISTAF
AMTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSDLVSANRLF
GDKSLTFNESYQDVSEVVYGAKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAI
NELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKVDGQSCPVPMMYQEGKFKYRRVAEGT
QVLELPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEWLDELSETMLVVHMPRFRTED
GFSLKEQLQDMGLIDLFSPEKSQLPGIVAGGRDDLYVSDAFHKAFLEVNEEGSEAAASTS
VVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCVN
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtattcccctggggcaggaagtggggctgctggtgagaggaagctttgtctcctctct
ctgctcctcatcggtgccttgggctgtgctatctgtcacggaaaccctgtggacgacatc
tgcatagcgaagccccgagacatccccgtgaatcccttgtgcatttaccgctcccctggg
aagaaggccaccgaggaggatggctcagagcagaaggttccagaagccaccaaccggcgg
gtctgggaactgtccaaggccaattcgcgatttgccactaacttctaccagcacctggca
gactccaagaatgacaacgacaacattttcctgtcacccttgagcatctccactgctttt
gctatgaccaagctgggtgcctgtaacgacactctcaagcagctgatggaggtttttaaa
tttgataccatctccgagaagacatccgaccagatccacttcttctttgccaaactgaac
tgccgactctatcgaaaagccaacaagtcctctgacttggtatcagccaaccgccttttt
ggagacaaatccctcaccttcaacgagagctatcaagatgttagtgaggttgtctatgga
gccaagctccagcccctggacttcaaggagaatccggagcaatccagagtgaccatcaac
aactgggtagctaataagactgaaggccgcatcaaagatgtcatcccacagggcgccatt
aacgagctcactgccctggttctggttaacaccatttacttcaagggcctgtggaagtca
aagttcagccctgagaacacaaggaaggaaccgttctataaggtcgatgggcagtcatgc
ccagtgcctatgatgtaccaggaaggcaaattcaaataccggcgcgtggcagagggcacc
caggtgctagagctgcccttcaagggggatgacatcaccatggtgctcatcctgcccaag
cctgagaagagcctggccaaggtggagcaggagctcaccccagagctgctgcaggagtgg
ctggatgagctgtcagagactatgcttgtggtccacatgccccgcttccgcaccgaggat
ggcttcagtctgaaggagcagctgcaagacatgggcctcattgatctcttcagccctgaa
aagtcccaactcccagggatcgttgctggaggcagggacgacctctatgtctccgacgca
ttccacaaagcatttcttgaggtaaatgaggaaggcagtgaagcagcagcgagtacttct
gtcgtgattactggccggtcactgaaccccaatagggtgaccttcaaggccaacaggccc
ttcctggttcttataagggaagttgcactgaacactattatattcatggggagagtggct
aatccttgtgtgaactaa

DBGET integrated database retrieval system