KEGG   Mus musculus (mouse): 11907Help
Entry
11907             CDS       T01002                                 

Gene name
Ate1, AI225793, AW547406
Definition
(RefSeq) arginyltransferase 1
  KO
K00685  arginyl-tRNA---protein transferase [EC:2.3.2.8]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    11907 (Ate1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.8  arginyltransferase
     11907 (Ate1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    11907 (Ate1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATE_C ATE_N
Motif
Other DBs
NCBI-GeneID: 11907
NCBI-ProteinID: NP_038827
MGI: 1333870
Ensembl: ENSMUSG00000030850
Vega: OTTMUSG00000059393
UniProt: Q9Z2A5
Position
7; 7 F3
AA seq 516 aa AA seqDB search
MASWSAPSPSLVEYFEGQTSFQCGYCKNKLGSRSYGMWAHSMTVQDYQDLIDRGWRRSGK
YVYKPVMDQTCCPQYTIRCHPLQFQPSKSHKKVLKKMLKFLAKGEISKGNCEDEPMDSTV
EDAVDGDFALINKLDIKCDLKTLSDLKGSIESEEKEKEKSIKKEGSKEFIHPQSIEEKLG
SGEPSHPIKVHIGPKPGKGADLSKPPCRKAREMRKERQRLKRMQQASAAASEAQGQPVCL
LPKAKSNQPKSLEDLIFQSLPENASHKLEVRVVRSSPPSPQFRATFQESYQVYKRYQMVV
HKDPPDKPTVSQFTRFLCSSPLEAEHPADGPECGYGSFHQQYWLDGKIIAVGVLDILPYC
VSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMRYKGQY
RPSDLLCPETYVWVPIEQCLPSLDNSKYCRFNQDPEAEDEGRSKELDRLRVFHRRSAMPY
GVYKNHQEDPSEEAGVLEYANLVGQKCSERMLLFRH
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttggagcgcgccttcacctagccttgtagagtattttgagggccagacctcc
ttccagtgtggctactgcaagaacaagttgggcagtcgctcctatggcatgtgggcacat
tccatgacagtgcaggattatcaggatcttatagaccgaggatggagaagaagtgggaaa
tatgtgtacaaacctgtcatggatcaaacatgctgtcctcagtatacaataaggtgtcat
cctttacagtttcagccatcaaaatctcacaagaaagttttgaaaaaaatgctgaaattt
ctggctaaaggagagatctcgaaaggcaattgtgaggatgagcccatggattctacagtg
gaggatgctgttgacggtgactttgcattaattaacaagctggatataaagtgtgatctc
aaaacactcagtgacctcaaaggaagcatagagagtgaagagaaggagaaagaaaagagt
ataaagaaagaagggtctaaagaattcattcatccacaatctatagaggagaagttgggc
tctggtgaaccatcacatccaatcaaagttcatattggtcctaagccaggcaaaggggct
gacttgagtaagcctccatgtcggaaagcaagggaaatgaggaaagaaaggcaaagatta
aaacggatgcagcaggcctcagctgcagcctcggaggctcaaggtcagccagtctgtttg
ttaccaaaggctaaatccaaccagcccaagtcactggaagatttgatttttcaatcttta
ccagaaaatgcatcgcacaagttagaggtgagggtggtaagatcttctccaccaagtcct
cagttcagagccacatttcaggagtcttaccaggtctataaacgctaccagatggttgtt
cacaaggacccgcctgataagccaaccgtgagccagtttacaagattcctttgcagctca
ccattggaggcagagcaccctgctgatggaccagaatgtggttatggctcctttcaccag
cagtactggctcgatgggaagatcattgctgtgggggtgttagacattctcccgtactgt
gtgtcttctgtgtatctctactacgatcctgattattcatttctgtctttgggtgtctat
tcagcattaagagaaattgcttttactagacaactgcatgagaaaacatcgcaactcagc
tattattatatgggtttctacattcattcctgtcccaagatgagatacaagggtcaatat
agaccttctgatttgctgtgtcctgagacgtatgtctgggtgcccattgagcagtgcctg
ccttctctggacaactccaagtactgccgtttcaaccaggaccccgaagcagaggatgaa
ggacgcagtaaggaacttgaccgactaagggtgtttcacagacgatctgccatgccttac
ggtgtttataagaatcaccaagaagacccaagtgaggaggctggtgtgctggagtatgca
aacctcgtaggacagaagtgctcggagaggatgctgctgttcagacactga

DBGET integrated database retrieval system