KEGG   Mus musculus (mouse): 11909Help
Entry
11909             CDS       T01002                                 

Gene name
Atf2, Atf-2, CRE-BP, Creb2, D130078H02Rik, D18875, Tg(Gzma-Klra1)7Wum, mXBP
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing's syndrome
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05166  HTLV-I infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    11909 (Atf2)
   04668 TNF signaling pathway
    11909 (Atf2)
   04022 cGMP - PKG signaling pathway
    11909 (Atf2)
   04151 PI3K-Akt signaling pathway
    11909 (Atf2)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    11909 (Atf2)
   04922 Glucagon signaling pathway
    11909 (Atf2)
   04915 Estrogen signaling pathway
    11909 (Atf2)
   04926 Relaxin signaling pathway
    11909 (Atf2)
   04918 Thyroid hormone synthesis
    11909 (Atf2)
   04928 Parathyroid hormone synthesis, secretion and action
    11909 (Atf2)
   04925 Aldosterone synthesis and secretion
    11909 (Atf2)
   04927 Cortisol synthesis and secretion
    11909 (Atf2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11909 (Atf2)
  Nervous system
   04728 Dopaminergic synapse
    11909 (Atf2)
  Aging
   04211 Longevity regulating pathway - mammal
    11909 (Atf2)
  Environmental adaptation
   04714 Thermogenesis
    11909 (Atf2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    11909 (Atf2)
  Substance dependence
   05030 Cocaine addiction
    11909 (Atf2)
   05031 Amphetamine addiction
    11909 (Atf2)
   05034 Alcoholism
    11909 (Atf2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    11909 (Atf2)
  Infectious diseases
   05166 HTLV-I infection
    11909 (Atf2)
   05164 Influenza A
    11909 (Atf2)
   05161 Hepatitis B
    11909 (Atf2)
   05169 Epstein-Barr virus infection
    11909 (Atf2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    11909 (Atf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2
Motif
Other DBs
NCBI-GeneID: 11909
NCBI-ProteinID: NP_001020264
MGI: 109349
Ensembl: ENSMUSG00000027104
Vega: OTTMUSG00000013179
UniProt: P16951 Q543G2 Q640L6 Q68FE3
Position
2; 2 C3
AA seq 487 aa AA seqDB search
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPL
PHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVI
TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSV
PGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQP
ATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQ
SLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSS
EDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPPS
QAQPSGS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgacaaaccctttctatgcactgcccctgggtgtggccagcgttttaccaac
gaggatcatttggctgtccataaacataaacatgagatgacactgaaatttggtccagca
cgtaatgacagtgtcattgtggctgatcagactccaacgccaacaagattcctaaaaaac
tgtgaagaagtgggtttgttcaatgagttggcaagtccatttgaaaatgaattcaagaag
gcttccgaagatgacattaaaaaaatgcctctagatttgtcccctcttgcaacacccatc
ataagaagcaaaattgaggagccttctgttgtagaaacaactcaccaggacagcccttta
cctcaccccgagtcgactaccagtgatgaaaaggaagtaccattggcacaaactgcacag
cccacatcagctatcgttcgtccagcatcattacaggttcccaatgtgctgctcacaagt
tctgactcaagtgtaattattcaacaagcagtaccttcaccaacctcaagtactgtaatc
acccaggcaccatcctctaacaggccaattgttcctgtaccaggcccatttcctcttctc
ttacatcttcctaatggacaaaccatgcccgttgctattcctgcatcaattacaagttct
aatgtgcatgttccagctgcagtcccacttgttcggccagtcaccatggtgcctagtgtt
ccaggaatcccaggcccttcctctcctcaaccagtccagtcagaagcaaaaatgagatta
aaagctgctttgacccagcaacaccctccagttaccaatggtgatactgtaaaaggccat
ggcagtggattggttaggactcagtcagaagagtctcgcccacagtccttgcagcagcca
gccacctccactacagaaactccggcttctccagctcacacaactcctcagacccaaaat
acaagtggccgtcgaagaagagcagctaatgaagatcctgatgagaaaaggaggaagttt
ctagaacgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtgtgggttcag
tccttagagaagaaagcagaagacttgagttcactaaatggccagctgcagagcgaagtc
accctgctgagaaatgaagtggcccagctgaaacagcttcttctggctcataaagattgc
cctgtaactgccatgcagaagaagtctggctatcatactgctgataaagatgacagttca
gaagacctttctgtgccaagcagtccacatacagaagcgatccagcacagctctgtcagc
acatccaatggagtcagttcaacatcaaaagcagaagctgtagccacttcagtcctcacc
cagatggcggaccagagcacggagcctgcactttcacagattgtcatggctcctccctcc
caggcacagccctcaggaagttga

DBGET integrated database retrieval system