KEGG   Mus musculus (mouse): 11911Help
Entry
11911             CDS       T01002                                 

Gene name
Atf4, Atf-4, C/ATF, CREB2, TAXREB67
Definition
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04137  Mitophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04668  TNF signaling pathway
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    11911 (Atf4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    11911 (Atf4)
   04668 TNF signaling pathway
    11911 (Atf4)
   04022 cGMP-PKG signaling pathway
    11911 (Atf4)
   04151 PI3K-Akt signaling pathway
    11911 (Atf4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    11911 (Atf4)
  09143 Cell growth and death
   04210 Apoptosis
    11911 (Atf4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    11911 (Atf4)
   04922 Glucagon signaling pathway
    11911 (Atf4)
   04912 GnRH signaling pathway
    11911 (Atf4)
   04915 Estrogen signaling pathway
    11911 (Atf4)
   04926 Relaxin signaling pathway
    11911 (Atf4)
   04935 Growth hormone synthesis, secretion and action
    11911 (Atf4)
   04918 Thyroid hormone synthesis
    11911 (Atf4)
   04928 Parathyroid hormone synthesis, secretion and action
    11911 (Atf4)
   04925 Aldosterone synthesis and secretion
    11911 (Atf4)
   04927 Cortisol synthesis and secretion
    11911 (Atf4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11911 (Atf4)
  09156 Nervous system
   04725 Cholinergic synapse
    11911 (Atf4)
   04728 Dopaminergic synapse
    11911 (Atf4)
   04720 Long-term potentiation
    11911 (Atf4)
   04722 Neurotrophin signaling pathway
    11911 (Atf4)
  09149 Aging
   04211 Longevity regulating pathway
    11911 (Atf4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    11911 (Atf4)
  09162 Cancer: specific types
   05215 Prostate cancer
    11911 (Atf4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11911 (Atf4)
  09165 Substance dependence
   05030 Cocaine addiction
    11911 (Atf4)
   05031 Amphetamine addiction
    11911 (Atf4)
   05034 Alcoholism
    11911 (Atf4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    11911 (Atf4)
   04934 Cushing syndrome
    11911 (Atf4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    11911 (Atf4)
   05161 Hepatitis B
    11911 (Atf4)
   05163 Human cytomegalovirus infection
    11911 (Atf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11911 (Atf4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    11911 (Atf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 APG6_N DUF4407 DUF4795 Fez1 Laminin_II DUF3450 AAA_13
Motif
Other DBs
NCBI-GeneID: 11911
NCBI-ProteinID: NP_001274109
MGI: 88096
Ensembl: ENSMUSG00000042406
UniProt: Q06507 Q8CF69
Position
15 E1; 15 37.85 cM
AA seq 349 aa AA seqDB search
MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
AMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCD
LFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLE
LGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRA
PPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAE
QEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgaacagcgaagtgttggcgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgactatctggaggtg
gccaagcacttgaaacctcatgggttctccagcgacaaggcgggctcctcggaatggccg
gctatggatgatggcttggccagtgcctcagacaccggcaaggaggatgccttttccggg
acagattggatgttggagaaaatggatctgaaagagtttgacttcgatgctctgtttcga
atggatgacctggaaaccatgccagatgagctcttgaccacgttggatgacacatgtgat
ctttttgcccctctagtccaagagactaataaggagccccctcagacagtgaacccaatt
ggccatctcccagaaagtttaataaaagtcgaccaggttgccccctttacattcttgcag
cctttcccctgttccccaggggttctgtcttccactccagagcattcctttagtttagag
ctaggcagtgaagttgatatctctgaaggagacaggaagcctgactctgctgcttacatt
actctaatccctccatgtgtaaaggaggaagacactccctctgacaatgacagtggcatc
tgtatgagcccagagtcctacctgggctctccccagcatagcccctccacctccagggcc
ccaccagacaatctgccttctccaggtggttcccgtgggtctcctcggcccaaaccttat
gacccacctggagttagtttgacagctaaagtgaagactgagaaattggataagaagctg
aaaaagatggagcaaaacaagacagcagccactaggtaccgccagaagaagcgggctgag
caggaggccctcactggcgagtgtaaggagctagaaaaaaagaatgaggctctgaaagag
aaggcagattctctggccaaggagatccagtatctgaaagacctgatagaagaggtccgt
aaggcaagggggaagaagagagttccgtaa

DBGET integrated database retrieval system